DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and piit-1

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_505943.2 Gene:piit-1 / 185259 WormBaseID:WBGene00009384 Length:200 Species:Caenorhabditis elegans


Alignment Length:57 Identity:21/57 - (36%)
Similarity:34/57 - (59%) Gaps:3/57 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NCYVGRNEGNFCSRKDQTKVVTRWYFDK-GVCKPFNYKGCNGNRNRFCSQESCDARC 109
            :|:..|:.||.|:....:::.  :|..: |.|:||.|:||.||.|||.|.:.|.:.|
 Worm    23 DCFAARDSGNTCAENSSSRMF--YYLPRLGTCQPFMYQGCGGNSNRFSSAQECRSAC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 15/35 (43%)
piit-1NP_505943.2 Kunitz_BPTI 24..77 CDD:425421 20/54 (37%)
KU 137..192 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.