DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and C54D10.10

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_506123.2 Gene:C54D10.10 / 183787 WormBaseID:WBGene00008304 Length:216 Species:Caenorhabditis elegans


Alignment Length:58 Identity:22/58 - (37%)
Similarity:32/58 - (55%) Gaps:5/58 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NCYVGRNEGNFCSRKDQTKVVTRWYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARC 109
            ||...::.|..|   |...:..::|||  ..||:|..|:||.||.|||.|:::|...|
 Worm    20 NCRQEKDTGVNC---DNKPITLKFYFDMRTNVCQPLFYRGCGGNENRFESRDACSDAC 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 16/36 (44%)
C54D10.10NP_506123.2 Kunitz_BPTI 21..75 CDD:425421 21/57 (37%)
KU 158..213 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.