DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and C10G8.3

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_504417.2 Gene:C10G8.3 / 182502 WormBaseID:WBGene00015682 Length:190 Species:Caenorhabditis elegans


Alignment Length:36 Identity:14/36 - (38%)
Similarity:18/36 - (50%) Gaps:2/36 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 RWYFD--KGVCKPFNYKGCNGNRNRFCSQESCDARC 109
            |:|.|  ...|..|||.||..|.|.|.:.::|...|
 Worm    48 RYYMDVPTETCLAFNYTGCGHNWNNFATSQACYEEC 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 13/34 (38%)
C10G8.3NP_504417.2 KU 29..83 CDD:197529 13/34 (38%)

Return to query results.
Submit another query.