DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and C34F6.1

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_509868.1 Gene:C34F6.1 / 181306 WormBaseID:WBGene00007938 Length:1043 Species:Caenorhabditis elegans


Alignment Length:74 Identity:25/74 - (33%)
Similarity:37/74 - (50%) Gaps:15/74 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 NNFNCYVG--RNEGNFC--SRK---------DQTKVVTRWYFDKGV--CKPFNYKGCNGNRNRFC 100
            |.:.|:||  ....|.|  :|:         ...:.:.||:||.|:  |:||.|||..||.|.|.
 Worm   750 NGYYCHVGGAPETTNCCPGTRRPCDLPLEVGQGVEKLERWFFDGGIQMCRPFVYKGMKGNSNNFL 814

  Fly   101 SQESCDARC 109
            :::||...|
 Worm   815 TKQSCRQSC 823

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 17/36 (47%)
C34F6.1NP_509868.1 Lustrin_cystein 185..231 CDD:464222
Kunitz_conkunitzin 239..289 CDD:438636
Lustrin_cystein 304..343 CDD:464222
Kunitz_conkunitzin 352..402 CDD:438636
Kunitz_conkunitzin 457..511 CDD:438636
Kunitz_conkunitzin 566..616 CDD:438636
Lustrin_cystein 622..663 CDD:464222
Kunitz_conkunitzin 669..719 CDD:438636
Lustrin_cystein 725..767 CDD:464222 5/16 (31%)
Kunitz_conkunitzin 773..823 CDD:438636 17/49 (35%)
Lustrin_cystein 828..873 CDD:464222
Kunitz_conkunitzin 880..930 CDD:438636
Kunitz_BPTI 982..1033 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.