DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and C02F12.5

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_508632.2 Gene:C02F12.5 / 180656 WormBaseID:WBGene00015355 Length:176 Species:Caenorhabditis elegans


Alignment Length:50 Identity:19/50 - (38%)
Similarity:25/50 - (50%) Gaps:5/50 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 GNFCSRKDQTKVVTRWYFDKGV--CKPFNYKGCNGNRNRFCSQESCDARC 109
            |..||   :.|..|:||:|..:  |.|:.|.||....|.|.|.|:|...|
 Worm    28 GTACS---ENKTSTKWYYDSKLLFCYPYKYLGCGEGSNSFESNENCLESC 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/36 (39%)
C02F12.5NP_508632.2 KU <34..74 CDD:197529 15/39 (38%)

Return to query results.
Submit another query.