DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and F22E12.1

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_505684.2 Gene:F22E12.1 / 179460 WormBaseID:WBGene00009058 Length:763 Species:Caenorhabditis elegans


Alignment Length:72 Identity:27/72 - (37%)
Similarity:35/72 - (48%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GNGAVVSCKELNNFNCYVGRNEGNFCSRKDQTKVVTRWYFDK--GVCKPFNYKGCNGNRNRFCSQ 102
            |..||.|.:.|:|..|....:.|. |......|    ||:|:  ..|:.|.|.||.||.|||.|.
 Worm    10 GCTAVNSQQLLSNPKCNHWPDRGT-CELDFHVK----WYYDRYDHRCRRFFYGGCEGNENRFDSL 69

  Fly   103 ESCDARC 109
            |.|.::|
 Worm    70 EECSSQC 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 16/36 (44%)
F22E12.1NP_505684.2 Kunitz-type 25..76 CDD:438633 20/55 (36%)
KU 85..137 CDD:197529
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.