DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and F30H5.3

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:NP_497206.1 Gene:F30H5.3 / 175207 WormBaseID:WBGene00017937 Length:1599 Species:Caenorhabditis elegans


Alignment Length:87 Identity:28/87 - (32%)
Similarity:39/87 - (44%) Gaps:17/87 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SGNGAVVSCKELNNFNCYVGRNEGNFCSRKDQT------KVVT-------RWYFDKGV--CKPFN 88
            |.:||..||..  |:.||........|..|..|      |.||       |:|::...  |:.:.
 Worm   639 SNSGAGNSCPV--NYECYFDGYVWGCCPTKAYTCTLSPHKGVTCGSGSSYRYYYNSQTQECESYQ 701

  Fly    89 YKGCNGNRNRFCSQESCDARCG 110
            |.||:||.|.|.::|.|:..||
 Worm   702 YNGCDGNSNNFATREDCEGYCG 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 14/43 (33%)
F30H5.3NP_497206.1 EB 135..182 CDD:460294
KU 330..391 CDD:197529
KU <481..516 CDD:197529
Kunitz_BPTI 562..613 CDD:425421
Kunitz_BPTI 669..723 CDD:425421 16/53 (30%)
Kunitz_BPTI 776..829 CDD:425421
Lustrin_cystein 834..879 CDD:464222
Lustrin_cystein 885..930 CDD:464222
Lustrin_cystein 1105..1150 CDD:464222
EB 1212..1263 CDD:460294
EB 1267..1318 CDD:460294
Lustrin_cystein 1466..1511 CDD:464222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.