DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14298 and LOC100485348

DIOPT Version :10

Sequence 1:NP_650755.1 Gene:CG14298 / 42259 FlyBaseID:FBgn0038654 Length:111 Species:Drosophila melanogaster
Sequence 2:XP_031750923.1 Gene:LOC100485348 / 100485348 XenbaseID:XB-GENE-29077767 Length:206 Species:Xenopus tropicalis


Alignment Length:39 Identity:17/39 - (43%)
Similarity:25/39 - (64%) Gaps:2/39 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VVTRWYFDK--GVCKPFNYKGCNGNRNRFCSQESCDARC 109
            ::.:||::|  |.|..|.|.||.||.|||.::|:|...|
 Frog   102 LIPQWYYNKERGACHSFLYSGCQGNGNRFENKENCTTLC 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14298NP_650755.1 Kunitz-type <74..109 CDD:438633 16/36 (44%)
LOC100485348XP_031750923.1 Kunitz-type 23..75 CDD:444694
Kunitz-type 87..140 CDD:444694 16/37 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.