DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Octalpha2R and DopEcR

DIOPT Version :9

Sequence 1:NP_001262715.1 Gene:Octalpha2R / 42258 FlyBaseID:FBgn0038653 Length:740 Species:Drosophila melanogaster
Sequence 2:NP_001014559.1 Gene:DopEcR / 38539 FlyBaseID:FBgn0035538 Length:322 Species:Drosophila melanogaster


Alignment Length:221 Identity:64/221 - (28%)
Similarity:107/221 - (48%) Gaps:13/221 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 SIIVTILMIIIVVGNMLVIIAIATEKSLKNIQNWFIASLAVADFFLGLIIMPFSLANELMGYWIF 183
            :::::||.:.||:.|:|:|...|..|....:.|:::.|||:||...||:::|||:...|.|.|::
  Fly    19 AVLISILGVAIVLSNLLIIATYANFKGPTEVINYYLLSLAIADLLCGLLVVPFSVYPALTGEWMY 83

  Fly   184 GSWWCDIHSAMDVLLCTASIMNLCLISLDRYWSITKAVDYLKSRTPARAAVMITAVWIMSALICI 248
            |...|.....::|.|...|:.....||:|||.::.|.:.|...:|..|....:...||.:||:|.
  Fly    84 GDIVCRFTGYLEVTLWAVSVYTFMWISVDRYLAVRKPLRYETVQTKTRCQCWMVFTWISAALLCC 148

  Fly   249 PPLLGWKVKMPEGPLPKCELSEDIG-YVLYSALGSFYI--PSCIMVFVYIRIYFAAKARARRGIK 310
            ||:||:.:.:.......|.|  |.| ...|||..:..:  ||.|.:.......|....:.|.|..
  Fly   149 PPILGYSMPIENNMTHICML--DWGNMAAYSATLAILVLGPSLISIVHNYGYIFVMMRKIRSGEP 211

  Fly   311 KHPRKTNNEQVTSFTTAKKGTIPMPS 336
            .|.::        :.||....:..||
  Fly   212 IHDKE--------YATALAENLSNPS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Octalpha2RNP_001262715.1 7tm_1 132..>315 CDD:278431 56/185 (30%)
7tm_4 133..>252 CDD:304433 40/118 (34%)
DopEcRNP_001014559.1 7tm_classA_rhodopsin-like 18..289 CDD:410626 64/221 (29%)
TM helix 1 18..42 CDD:410626 7/22 (32%)
TM helix 2 51..73 CDD:410626 10/21 (48%)
TM helix 3 89..111 CDD:410626 4/21 (19%)
TM helix 4 134..150 CDD:410626 5/15 (33%)
TM helix 5 174..197 CDD:410626 6/22 (27%)
TM helix 6 230..252 CDD:410626 64/221 (29%)
TM helix 7 264..289 CDD:410626
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.