DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7718 and SPO14

DIOPT Version :9

Sequence 1:NP_650751.3 Gene:CG7718 / 42254 FlyBaseID:FBgn0038649 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_012956.3 Gene:SPO14 / 853902 SGDID:S000001739 Length:1683 Species:Saccharomyces cerevisiae


Alignment Length:257 Identity:57/257 - (22%)
Similarity:95/257 - (36%) Gaps:77/257 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 IQVIHEPKHFY-----------------------ETLVQRIGQAK------RRIVLASLYLGTGQ 97
            :::|.:.:||.                       :.||.||.:|.      :..:|..|..|.  
Yeast   964 LKLIEQSEHFIYIENQFFITSTVWNGTCVLNKIGDALVDRIVKANQEKKPWKAFILIPLMPGF-- 1026

  Fly    98 LENAMVQTLRHSLEQQSALRLNVLLDFTRGTRGTLNSKTMLLPLVRDFASQVQ---LSLYHT--P 157
              ::.|.|     .:.|:|||.:...:...:||..::.:.|..|..|.|..:|   |..:.|  |
Yeast  1027 --DSPVDT-----AEASSLRLIMQFQYQSISRGEHSTFSKLKKLNIDPAQYIQFFSLRKWSTFAP 1084

  Fly   158 DLRGMTKRLAPPRWNELLGLQHMKVYLFDD-AVIISGANLS-NDYFTNRQDRY-ILIEDKPLA-- 217
            :.|.:|::|          ..|.|:.:.|| ..||..||:: .....||.... |||.|..|.  
Yeast  1085 NERLITEQL----------YVHAKILIADDRRCIIGSANINERSQLGNRDSEVAILIRDTDLIKT 1139

  Fly   218 -----DFYA-----QFIERVQEFSLAVAPDASEGLHRNWRILPYEGTKEQFIQLARKRISDL 269
                 |:||     :..:|:....|....|..|.:.:.:         |:|.:.|.|....|
Yeast  1140 KMNGDDYYAGKFPWELRQRLMREHLGCDVDLVEFVEKKF---------ERFEKFAAKNYEKL 1192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7718NP_650751.3 PLDc_PGS1_euk_1 61..227 CDD:197233 48/213 (23%)
PLDc_2 75..226 CDD:289836 45/176 (26%)
PLDc_PGS1_euk_2 289..474 CDD:197235
SPO14NP_012956.3 PX_domain 300..>390 CDD:413376
PH_PLD 473..660 CDD:269956
PLN02866 <638..1165 CDD:215467 49/219 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.