DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGS1 and zuc

DIOPT Version :10

Sequence 1:NP_650751.3 Gene:PGS1 / 42254 FlyBaseID:FBgn0038649 Length:494 Species:Drosophila melanogaster
Sequence 2:NP_609530.1 Gene:zuc / 34609 FlyBaseID:FBgn0261266 Length:253 Species:Drosophila melanogaster


Alignment Length:56 Identity:14/56 - (25%)
Similarity:27/56 - (48%) Gaps:2/56 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 NLTLIGSSNFGERSVNRDLETQVCLVTANKDLSQRLQAEADRLYDLSQTAEREIVQ 476
            ::.:.||.|:....:..:.|.  |::||:..|:...|||..|::......|...:|
  Fly   198 SIVISGSVNWTALGLGGNWEN--CIITADDKLTATFQAEFQRMWRAFAKTEGSQIQ 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGS1NP_650751.3 PLDc_PGS1_euk_1 61..227 CDD:197233
PLDc_PGS1_euk_2 289..474 CDD:197235 13/52 (25%)
zucNP_609530.1 PLDc_SF 87..239 CDD:472788 12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.