powered by:
Protein Alignment CG7718 and zuc
DIOPT Version :9
Sequence 1: | NP_650751.3 |
Gene: | CG7718 / 42254 |
FlyBaseID: | FBgn0038649 |
Length: | 494 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_609530.1 |
Gene: | zuc / 34609 |
FlyBaseID: | FBgn0261266 |
Length: | 253 |
Species: | Drosophila melanogaster |
Alignment Length: | 56 |
Identity: | 14/56 - (25%) |
Similarity: | 27/56 - (48%) |
Gaps: | 2/56 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 NLTLIGSSNFGERSVNRDLETQVCLVTANKDLSQRLQAEADRLYDLSQTAEREIVQ 476
::.:.||.|:....:..:.|. |::||:..|:...|||..|::......|...:|
Fly 198 SIVISGSVNWTALGLGGNWEN--CIITADDKLTATFQAEFQRMWRAFAKTEGSQIQ 251
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1502 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.