DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7718 and zuc

DIOPT Version :9

Sequence 1:	NP_650751.3	Gene:	CG7718 / 42254	FlyBaseID:	FBgn0038649	Length:	494	Species:	Drosophila melanogaster
Sequence 2:	NP_609530.1	Gene:	zuc / 34609	FlyBaseID:	FBgn0261266	Length:	253	Species:	Drosophila melanogaster

Alignment Length:	56	Identity:	14/56 - (25%)
Similarity:	27/56 - (48%)	Gaps:	2/56 - (3%)

- Green bases have known domain annotations that are detailed below.

  Fly   421 NLTLIGSSNFGERSVNRDLETQVCLVTANKDLSQRLQAEADRLYDLSQTAEREIVQ 476
            ::.:.||.|:....:..:.|.  |::||:..|:...|||..|::......|...:|
  Fly   198 SIVISGSVNWTALGLGGNWEN--CIITADDKLTATFQAEFQRMWRAFAKTEGSQIQ 251

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7718	NP_650751.3	PLDc_PGS1_euk_1	61..227	CDD:197233
		PLDc_2	75..226	CDD:289836
		PLDc_PGS1_euk_2	289..474	CDD:197235	13/52 (25%)
zuc	NP_609530.1	PLDc_SF	87..239	CDD:301585	12/42 (29%)
zuc	NP_609530.1	PLDc_2	96..239	CDD:289836	12/42 (29%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG1502
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.900