DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7718 and Pld1

DIOPT Version :9

Sequence 1:NP_650751.3 Gene:CG7718 / 42254 FlyBaseID:FBgn0038649 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_006232267.1 Gene:Pld1 / 25096 RGDID:3349 Length:1074 Species:Rattus norvegicus


Alignment Length:375 Identity:79/375 - (21%)
Similarity:121/375 - (32%) Gaps:128/375 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 DKPLADFYAQFIERVQEFSLAVAP--DASEGLHRNWRILPYEGTKEQFIQLARKRISDLVQETFQ 275
            |||.|||       :..:|....|  |....:|                   .|...|:.:...|
  Rat   661 DKPFADF-------IDRYSTPRMPWHDIGSVVH-------------------GKAARDVARHFIQ 699

  Fly   276 RQARTKEQNPQADTWIFP-LLEMGQIGIH----------HDSVVTKRLLSNCLSGSR-------- 321
            |...||...|:..:..:| ||...|...|          |......|..::..:|.:        
  Rat   700 RWNFTKIMKPKYRSLSYPFLLPKSQATAHELRYQVPGAVHAKAQLLRSAADWSAGIKHHEESIHA 764

  Fly   322 -----LKLATGYFNLTQEYMDTLTH---------KCLAQCSILMAH------------PNANGFQ 360
                 ::.:..|..:..::..:...         ..:|| .||.||            |...||:
  Rat   765 AYTHVIENSKHYIYIENQFFISCADDKVVFNKVGNAIAQ-RILKAHREGQRYRVYIVIPLLPGFE 828

  Fly   361 GAKGPAGG------IPAAYTLIAK---SFYESLVRRKQNHRVNFFEYEKPGWTYHAK-------G 409
            |.....||      :...|..:.:   |..|.|.....|..:|:..:  .|...||:       .
  Rat   829 GDISTGGGNALQAIMHFNYRTMCRGESSILEQLKPELGNKWINYISF--CGLRTHAELEGNLVTE 891

  Fly   410 LWYYLPEAIL--PNLTLIGSSNFGERSV--NRDLETQVCL--------VTANKD-----LSQRLQ 457
            |.|...:.::  .|..:|||:|..:||:  .||.|..|.:        |...|:     .:|.|:
  Rat   892 LIYVHSKLLIADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGKEYQAGRFAQGLR 956

  Fly   458 AEADRL---YDLSQTAEREIVQRPVPR------WVQAVVR-------IFR 491
            .|..||   | ||..:|.  :|.||..      ||....|       :||
  Rat   957 LECFRLVLGY-LSDPSED--IQDPVSDKFFKEIWVSTAARNATIYDKVFR 1003

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7718NP_650751.3 PLDc_PGS1_euk_1 61..227 CDD:197233 6/13 (46%)
PLDc_2 75..226 CDD:289836 6/12 (50%)
PLDc_PGS1_euk_2 289..474 CDD:197235 54/265 (20%)
Pld1XP_006232267.1 PX_PLD1 78..209 CDD:132829
PLN02866 82..1059 CDD:215467 79/375 (21%)
PH_PLD 197..326 CDD:269956
PLDc_vPLD1_1 352..502 CDD:197300
PLDc_vPLD1_2 754..935 CDD:197302 36/183 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.