Sequence 1: | NP_650751.3 | Gene: | CG7718 / 42254 | FlyBaseID: | FBgn0038649 | Length: | 494 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016879799.2 | Gene: | PLD6 / 201164 | HGNCID: | 30447 | Length: | 300 | Species: | Homo sapiens |
Alignment Length: | 202 | Identity: | 38/202 - (18%) |
---|---|---|---|
Similarity: | 58/202 - (28%) | Gaps: | 72/202 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 231 SLAVAPDASEGLHRNWRILPYEGTKEQFIQLARKRISDLVQETFQRQARTKEQNPQADTWIFP-- 293
Fly 294 ------LL-----EMGQI------GIHHDSVVTKRLLSNCLSGSRLKLATGYFNLTQEYMD---T 338
Fly 339 LTH------KCLAQCSILMAHPNANGFQGAKGPAGGIPAAYTLIAKSFYESLVRRKQNHRVNFFE 397
Fly 398 YEKPGWT 404 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7718 | NP_650751.3 | PLDc_PGS1_euk_1 | 61..227 | CDD:197233 | |
PLDc_2 | 75..226 | CDD:289836 | |||
PLDc_PGS1_euk_2 | 289..474 | CDD:197235 | 27/144 (19%) | ||
PLD6 | XP_016879799.2 | PLDc_SF | 139..>185 | CDD:326546 | 5/45 (11%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1502 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |