DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7718 and PLD6

DIOPT Version :9

Sequence 1:NP_650751.3 Gene:CG7718 / 42254 FlyBaseID:FBgn0038649 Length:494 Species:Drosophila melanogaster
Sequence 2:XP_016879799.2 Gene:PLD6 / 201164 HGNCID:30447 Length:300 Species:Homo sapiens


Alignment Length:202 Identity:38/202 - (18%)
Similarity:58/202 - (28%) Gaps:72/202 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SLAVAPDASEGLHRNWRILPYEGTKEQFIQLARKRISDLVQETFQRQARTKEQNPQADTWIFP-- 293
            |..||..|:.||......||:                      ..|..|::.:.|:.:...||  
Human    49 SWQVAAAAAVGLALTLEALPW----------------------VLRWLRSRRRRPRREALFFPSQ 91

  Fly   294 ------LL-----EMGQI------GIHHDSVVTKRLLSNCLSGSRLKLATGYFNLTQEYMD---T 338
                  ||     |:.::      |:.|......||| ..|..:|..|....|..:...:.   .
Human    92 VTCTEALLRAPGAELAELPEGCPCGLPHGESALSRLL-RALLAARASLDLCLFAFSSPQLGRAVQ 155

  Fly   339 LTH------KCLAQCSILMAHPNANGFQGAKGPAGGIPAAYTLIAKSFYESLVRRKQNHRVNFFE 397
            |.|      :.:..|..:..:.:..|.......:|.|....|.|.     ||             
Human   156 LLHQRGVRVRVVTDCDYMALNGSQIGLLRKGSRSGTIKTQATCIT-----SL------------- 202

  Fly   398 YEKPGWT 404
               |.||
Human   203 ---PSWT 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7718NP_650751.3 PLDc_PGS1_euk_1 61..227 CDD:197233
PLDc_2 75..226 CDD:289836
PLDc_PGS1_euk_2 289..474 CDD:197235 27/144 (19%)
PLD6XP_016879799.2 PLDc_SF 139..>185 CDD:326546 5/45 (11%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.