DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and KIC1

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_011970.1 Gene:KIC1 / 856502 SGDID:S000001144 Length:1080 Species:Saccharomyces cerevisiae


Alignment Length:263 Identity:89/263 - (33%)
Similarity:138/263 - (52%) Gaps:21/263 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1288 IGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKH-KNLVRYYGIEVHR 1351
            ||:|:||.||...|..||.:.|:|.:.:. .::..:::|..|::.|..:|. .|:.||||..:..
Yeast    29 IGRGKFGVVYKGYNVKTGRVYAIKVLNLD-SDSDEVEDVQREIQFLASLKQISNITRYYGSYLKD 92

  Fly  1352 EELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGS 1416
            ..|.|.||.|:.|:|.||:. .|.:.|........:||..:..:||..::|||||.||: |:...
Yeast    93 TSLWIIMEHCAGGSLRSLLR-PGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANV-LITNE 155

  Fly  1417 NSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDG--HGRAADIWSVGCVVVEM 1479
            .::||.|||.|.::. .|::  ..|...||..:|||||.    .:|  :....||||:|....|:
Yeast   156 GNVKLCDFGVAAQVN-QTSL--RRQTMAGTPYWMAPEVI----MEGVYYDTKVDIWSLGITTYEI 213

  Fly  1480 ASGKRPWAQFDS--NFQIMFKVGMGEKPQAPE--SLSQEGHDFIDHCLQHDPKRRLTAVELLEHN 1540
            |:|..|:...::  ..|::.|    .||...|  |.|....:||..||..|||.||:|.:||:..
Yeast   214 ATGNPPYCDVEALRAMQLIIK----SKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSK 274

  Fly  1541 FCK 1543
            |.:
Yeast   275 FIR 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 88/260 (34%)
S_TKc 1282..1541 CDD:214567 88/259 (34%)
KIC1NP_011970.1 STKc_NAK1_like 21..295 CDD:270822 89/263 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.