DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and CDC15

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_009411.2 Gene:CDC15 / 851274 SGDID:S000000072 Length:974 Species:Saccharomyces cerevisiae


Alignment Length:310 Identity:96/310 - (30%)
Similarity:160/310 - (51%) Gaps:27/310 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1262 VKSLNSSDKVHI----RARSVHFRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRA 1322
            :.|:..:|:|::    ||.....::|....||:|.:|.||.|:|.:|.:::|:||:..:..|  .
Yeast     1 MNSMADTDRVNLTPIQRASEKSVQYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDE--E 63

  Fly  1323 LKNVAEELKILEGIKHKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTG-NLPEALTRRFTA 1386
            |.::..|:.:|:.:.|.|:|:|:|......||.|.:|.|:.|:|..|:..:. .|.|..::.:..
Yeast    64 LNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSENESKTYVT 128

  Fly  1387 QLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMA 1451
            |.|.|:..||..|::|||||.||| |:...|::||.|||      ..|.|........||..:||
Yeast   129 QTLLGLKYLHGEGVIHRDIKAANI-LLSADNTVKLADFG------VSTIVNSSALTLAGTLNWMA 186

  Fly  1452 PEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQF-DSNFQIMFKVGMGEKPQAPESLSQEG 1515
            ||:.   .:.|....:||||:|..||||.:...|:... |:|  |.:.| ..:....|.|.|:..
Yeast   187 PEIL---GNRGASTLSDIWSLGATVVEMLTKNPPYHNLTDAN--IYYAV-ENDTYYPPSSFSEPL 245

  Fly  1516 HDFIDHCLQHDPKRRLTAVELLEHNFCKYGRDECSSEQLQMQVRGSFRRN 1565
            .||:..|...:..:|.||.:||:|.:..      |:|.:::.....|:.:
Yeast   246 KDFLSKCFVKNMYKRPTADQLLKHVWIN------STENVKVDKLNKFKED 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 88/262 (34%)
S_TKc 1282..1541 CDD:214567 88/260 (34%)
CDC15NP_009411.2 PKc_like 24..272 CDD:419665 88/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002637
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.