DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and NP2

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001319236.1 Gene:NP2 / 841937 AraportID:AT1G54960 Length:651 Species:Arabidopsis thaliana


Alignment Length:309 Identity:120/309 - (38%)
Similarity:183/309 - (59%) Gaps:15/309 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly  1253 LRERRLIGQVKSLNSSDKVHIRARSVHFRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQP 1317
            :|:..:..:.:|..::..|.|:.   ..||.:|..||:|.||.||..:|.::|||:|:|::.|..
plant    42 IRKSMVFAKSQSPPNNSTVQIKP---PIRWRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLITS 103

  Fly  1318 G-----ETRA-LKNVAEELKILEGIKHKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNL 1376
            .     :|:| ::.:.||:|:|:.:.|.|:|||.|.....|.|.|.:|....|::.||:|..|..
plant   104 NCASKEKTQAHIQELEEEVKLLKNLSHPNIVRYLGTVREDETLNILLEFVPGGSISSLLEKFGAF 168

  Fly  1377 PEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQ 1441
            ||::.|.:|.|||.|:..||.|.|:|||||.||| |||....:||.|||::.::....|:.| .:
plant   169 PESVVRTYTNQLLLGLEYLHNHAIMHRDIKGANI-LVDNQGCIKLADFGASKQVAELATISG-AK 231

  Fly  1442 GYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEK-P 1505
            ...||..:|||||..:|   ||..:||||||||.|:||.:||.||:|.......:|.:|..:. |
plant   232 SMKGTPYWMAPEVILQT---GHSFSADIWSVGCTVIEMVTGKAPWSQQYKEIAAIFHIGTTKSHP 293

  Fly  1506 QAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCKYGRDECSSEQL 1554
            ..|:::|.:.:||:..|||.:|..|.||.|||:|.|....:.|.:|:.|
plant   294 PIPDNISSDANDFLLKCLQQEPNLRPTASELLKHPFVTGKQKESASKDL 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 112/267 (42%)
S_TKc 1282..1541 CDD:214567 111/265 (42%)
NP2NP_001319236.1 STKc_MAPKKK 67..330 CDD:270783 112/267 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2506
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.