DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and MAP3KA

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_564635.1 Gene:MAP3KA / 841792 AraportID:AT1G53570 Length:609 Species:Arabidopsis thaliana


Alignment Length:472 Identity:151/472 - (31%)
Similarity:231/472 - (48%) Gaps:76/472 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1126 ASPRTRKTSSPATSRSRTPTR--TPM------------------SAGMVLNPNTPPLQSPPYNKL 1170
            ::.|..|:|:.......||||  ||.                  |.....:|...||.||   ..
plant    22 STDRDIKSSAVVVDPPLTPTRGGTPRCSREFAGASSAFSGFDSDSTEKKGHPLPRPLLSP---VS 83

  Fly  1171 LHPQFSLKEDVSG-TSYSPVDSSDYVDTPCQRSAN---GELRLLVPQTPPTP--ASPGKSSLEST 1229
            :|.|..:....|| ||.|.|.||...|...|..|:   |:::..|...|.:|  .||..:::.:.
plant    84 IHHQDHVSGSTSGSTSVSSVSSSGSADDQSQLVASRGRGDVKFNVAAAPRSPERVSPKAATITTR 148

  Fly  1230 PLALRQERVRDAVNRLDMDLEDGLRERRLIGQVKSLNSSDKVHIRAR---------SVH------ 1279
            |.:.|.:|:...|:     ||..      .|:.....||.:.|...|         :||      
plant   149 PTSPRHQRLSGVVS-----LESS------TGRNDDGRSSSECHPLPRPPTSPTSPSAVHGSRIGG 202

  Fly  1280 ---------FRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEI-AIQPGET--RALKNVAEELKI 1332
                     ..|.:|..:|.|.||:||...|:..|::.|:||: .|...:|  ..||.:.:|:.:
plant   203 GYETSPSGFSTWKKGKFLGSGTFGQVYLGFNSEKGKMCAIKEVKVISDDQTSKECLKQLNQEINL 267

  Fly  1333 LEGIKHKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHK 1397
            |..:.|.|:|:|||.|:..|.|.:::|..|.|::..|::..|:..|.:.:.:|.|:|:|::.||.
plant   268 LNQLCHPNIVQYYGSELSEETLSVYLEYVSGGSIHKLLKDYGSFTEPVIQNYTRQILAGLAYLHG 332

  Fly  1398 HGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDG 1462
            ...||||||.||| |||.:..:||.|||.|..:.|.:|    :..:.|:..:|||||....|  |
plant   333 RNTVHRDIKGANI-LVDPNGEIKLADFGMAKHVTAFST----MLSFKGSPYWMAPEVVMSQN--G 390

  Fly  1463 HGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMG-EKPQAPESLSQEGHDFIDHCLQHD 1526
            :..|.||||:||.::|||:.|.||:||: ....:||:|.. :.|:.|:.||.:..:||..|||.:
plant   391 YTHAVDIWSLGCTILEMATSKPPWSQFE-GVAAIFKIGNSKDTPEIPDHLSNDAKNFIRLCLQRN 454

  Fly  1527 PKRRLTAVELLEHNFCK 1543
            |..|.||.:||||.|.:
plant   455 PTVRPTASQLLEHPFLR 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 103/264 (39%)
S_TKc 1282..1541 CDD:214567 103/262 (39%)
MAP3KANP_564635.1 STKc_MEKK1_plant 213..470 CDD:270802 103/264 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2506
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48016
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.