DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and NP1

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_563832.2 Gene:NP1 / 837421 AraportID:AT1G09000 Length:666 Species:Arabidopsis thaliana


Alignment Length:294 Identity:119/294 - (40%)
Similarity:172/294 - (58%) Gaps:17/294 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1282 WHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPG-----ETRA-LKNVAEELKILEGIKHKN 1340
            |.:|..||:|.||.||..:|.::|||:|:|::.|...     :|:| ::.:.||:|:|:.:.|.|
plant    69 WRKGQLIGRGAFGTVYMGMNLDSGELLAVKQVLIAANFASKEKTQAHIQELEEEVKLLKNLSHPN 133

  Fly  1341 LVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDI 1405
            :|||.|.....:.|.|.:|....|::.||:|..|..||::.|.:|.|||.|:..||.|.|:||||
plant   134 IVRYLGTVREDDTLNILLEFVPGGSISSLLEKFGPFPESVVRTYTRQLLLGLEYLHNHAIMHRDI 198

  Fly  1406 KTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIW 1470
            |.||| |||....:||.|||::.::....|:.| .:...||..:|||||..:|   ||..:||||
plant   199 KGANI-LVDNKGCIKLADFGASKQVAELATMTG-AKSMKGTPYWMAPEVILQT---GHSFSADIW 258

  Fly  1471 SVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEK-PQAPESLSQEGHDFIDHCLQHDPKRRLTAV 1534
            ||||.|:||.:||.||:|.......:|.:|..:. |..|::||.:..||:..|||..|..|.||.
plant   259 SVGCTVIEMVTGKAPWSQQYKEVAAIFFIGTTKSHPPIPDTLSSDAKDFLLKCLQEVPNLRPTAS 323

  Fly  1535 ELLEHNFCKYGRDECSSEQLQMQVRGSFRRNVAT 1568
            |||:|.|......|.:|..|     ||...|::|
plant   324 ELLKHPFVMGKHKESASTDL-----GSVLNNLST 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 111/266 (42%)
S_TKc 1282..1541 CDD:214567 111/265 (42%)
NP1NP_563832.2 STKc_MAPKKK 68..331 CDD:270783 111/266 (42%)
S_TKc 69..331 CDD:214567 111/266 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2506
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.