DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and MAPKKK15

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001330365.1 Gene:MAPKKK15 / 835600 AraportID:AT5G55090 Length:510 Species:Arabidopsis thaliana


Alignment Length:266 Identity:93/266 - (34%)
Similarity:143/266 - (53%) Gaps:22/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1282 WHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYG 1346
            |.||..||:|....|...: .|:|:..|:|.     .|..:...:..|..||..:....:|:|.|
plant    68 WIRGPIIGRGSTATVSLGI-TNSGDFFAVKS-----AEFSSSAFLQREQSILSKLSSPYIVKYIG 126

  Fly  1347 IEVHRE--ELL--IFMELCSEGTLESLVELT-GNLPEALTRRFTAQLLSGVSELHKHGIVHRDIK 1406
            ..|.:|  :|:  :.||..|.|:|..|::.: |.|||.|.|.:|.|:|.|:..||..||||.|:|
plant   127 SNVTKENDKLMYNLLMEYVSGGSLHDLIKNSGGKLPEPLIRSYTRQILKGLMYLHDQGIVHCDVK 191

  Fly  1407 TANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWS 1471
            :.|:.:  |....|:.|.|.|..::.:..:.     :.||.|:|:|||   ...:.....||:|:
plant   192 SQNVMI--GGEIAKIVDLGCAKTVEENENLE-----FSGTPAFMSPEV---ARGEEQSFPADVWA 246

  Fly  1472 VGCVVVEMASGKRPWAQFDSNFQIMFKVGM-GEKPQAPESLSQEGHDFIDHCLQHDPKRRLTAVE 1535
            :||.|:|||:|..||.:.:.....::|:|. ||.|..|..||::|.||:..||:.|||:|.|..|
plant   247 LGCTVIEMATGSSPWPELNDVVAAIYKIGFTGESPVIPVWLSEKGQDFLRKCLRKDPKQRWTVEE 311

  Fly  1536 LLEHNF 1541
            ||:|.|
plant   312 LLQHPF 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 93/266 (35%)
S_TKc 1282..1541 CDD:214567 92/264 (35%)
MAPKKK15NP_001330365.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.