DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT5G27790

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_198131.1 Gene:AT5G27790 / 832841 AraportID:AT5G27790 Length:327 Species:Arabidopsis thaliana


Alignment Length:294 Identity:92/294 - (31%)
Similarity:140/294 - (47%) Gaps:52/294 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1285 GIK--IGQGRFGKVYTAVNNNTGELMAMKEIAIQPGET--------RALKNVAEELKILEGIKH- 1338
            |::  .|:|.||.|         .|.:.|...  .|||        ...|::.||.:||...|. 
plant    21 GVRKVFGKGSFGSV---------RLFSYKRRC--DGETLYATVKTSDDAKSLYEEFQILSKFKGC 74

  Fly  1339 KNLVRYYGIEVHRE-------ELLIFMELCSEGTLESLVELTGN--LPEALTRRFTAQLLSGVSE 1394
            ..:|:.||..|.:.       |.:|.||..:.|:|.:.::...:  ||:.:.|:||..||.|::.
plant    75 PRIVQCYGNGVKQRFNDKGYVEYMIPMEYATGGSLNNFMDRFNDRKLPDPMIRKFTRMLLEGLAT 139

  Fly  1395 LHKHGIVHRDIKTANIFLVDG----------SNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAY 1449
            :|::|.||.|||..||.:..|          |..||:.|||.: |....|.....|:.|.||:.|
plant   140 IHRYGYVHYDIKPENILVFPGSVYKEGAWRYSYKLKISDFGLS-KRDGDTKWWHPLKSYAGTRIY 203

  Fly  1450 MAPEVFTKTNSDGH-GRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQ 1513
            |:||    :.|.|. |:..|:||:||||:||.:|||||...:...:.:.|.   .:|..|.:|..
plant   204 MSPE----SISHGEIGKGLDLWSLGCVVLEMYTGKRPWWHTNYELEDLMKC---YEPLFPPNLPC 261

  Fly  1514 EGHDFIDHCLQHDPKRRLTAVELLEHNFCKYGRD 1547
            :...|:..|...:|..|..|:.||..:|  :.||
plant   262 DAKLFLMTCFAPEPDERKDALTLLRQSF--FRRD 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 89/287 (31%)
S_TKc 1282..1541 CDD:214567 89/286 (31%)
AT5G27790NP_198131.1 S_TKc 22..290 CDD:214567 89/288 (31%)
PKc_like 27..290 CDD:304357 89/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.