DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT5G27510

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_198103.1 Gene:AT5G27510 / 832811 AraportID:AT5G27510 Length:301 Species:Arabidopsis thaliana


Alignment Length:284 Identity:87/284 - (30%)
Similarity:133/284 - (46%) Gaps:52/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1288 IGQGRFGKV----YT---------AVNNNTGELMAMKEIAI---QPGETRALKNVAEELKILEGI 1336
            :|:|.:..|    ||         ||.::..|...:||..|   ..|..|.::....:|:  ||.
plant    11 LGEGAYSFVDLFKYTKSDGSSFHAAVKSSDDENSLLKEFHILSELKGCPRIIQCFGNDLE--EGF 73

  Fly  1337 KHKNLVRYYGIEVHREELLIFMELCSEGTLESLVE--LTGNLPEALTRRFTAQLLSGVSELHKHG 1399
            ..|      |..|::    :.:|..|||:|...:.  :...||:.:.|.||..:|.|:..:|.||
plant    74 DDK------GNRVYK----LLLEYASEGSLSDFMNNCVDRKLPDLMIRDFTRMILQGLVSIHSHG 128

  Fly  1400 IVHRDIKTAN--IFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQG-------YVGTQAYMAPEVF 1455
            .||.|:|..|  :|....|..:|:.|||.::::       ||:..       :|||..||.||  
plant   129 YVHCDLKPENVLVFPCGDSYEVKISDFGLSLQV-------GEVPDHWKIEYPFVGTLNYMPPE-- 184

  Fly  1456 TKTNSDG-HGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFI 1519
              :..|| ..:..|:||:||:|:||...|:||..|... ..::.:..|..|:.||||..:...||
plant   185 --SLHDGVANKTLDLWSLGCLVLEMYVCKKPWIGFIPE-DFVYILSNGNPPEIPESLPCDARAFI 246

  Fly  1520 DHCLQHDPKRRLTAVELLEHNFCK 1543
            ..|...:||.|.||.|||.|.|.:
plant   247 QKCFSRNPKERGTASELLSHRFLR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 86/281 (31%)
S_TKc 1282..1541 CDD:214567 86/280 (31%)
AT5G27510NP_198103.1 PKc_like 9..269 CDD:419665 86/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.