DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT5G12090

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_196770.1 Gene:AT5G12090 / 831082 AraportID:AT5G12090 Length:369 Species:Arabidopsis thaliana


Alignment Length:314 Identity:91/314 - (28%)
Similarity:155/314 - (49%) Gaps:59/314 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1272 HIRARSVHFRWHRGIKIGQGRFGKV----YTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKI 1332
            |:|.  :|.::     :|:|.:|.|    ||..:.::.:.......|....|..|||   .|::|
plant    24 HVRV--LHHKF-----LGKGVYGSVDLIRYTKTDGSSLQAAVKTSYAEDLEEYDALK---REIQI 78

  Fly  1333 LEGIK-HKNLVRYYGIEV------HREELL-IFMELCSEGTLESLVE--LTGNLPEALTRRFTAQ 1387
            |..:| :.|:|..||.::      |..::. :.:|..:||:|.|.:|  ....||:.:.|.||..
plant    79 LSELKGYPNIVICYGDDLEEDFNEHGHKVYKLLLEYANEGSLSSFMENYPDRKLPDPMIRDFTRM 143

  Fly  1388 LLSGVSELHKHGIVHRDIKTANIFLVDGSNS----LKLGDFGSAVKIQAHTTVPGELQG---YVG 1445
            :|.|:..:|.||.||.|:|:.|:.:....:|    ||:.|||:..::   ..||...:.   |||
plant   144 ILEGLVSMHSHGYVHCDLKSDNLLIFSRKDSASCELKIFDFGNCRQV---GEVPDHWKSDYPYVG 205

  Fly  1446 TQAYMAPEVFTKTNSDGHG-RAADIWSVGCVVVEMASGKRPWAQFDS----NFQIMFKVGMGEKP 1505
            |     ||.|    .||.. :..|:||:||:|:::.:|::||.:..|    ||     :..||.|
plant   206 T-----PESF----FDGVAKKTLDLWSLGCLVLKIYTGEQPWERVTSVDFVNF-----LSDGEAP 256

  Fly  1506 QAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCKYGRDECSSEQLQMQVR 1559
            ..||.:..:..:||:.|...:.::|.||.|||.|.|.      |..:.|.::::
plant   257 NIPEYVPCDAREFIETCFAREHEKRGTASELLLHPFL------CQKQPLLVKLK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 85/286 (30%)
S_TKc 1282..1541 CDD:214567 85/284 (30%)
AT5G12090NP_196770.1 PKc_like 31..293 CDD:389743 85/286 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.