DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and MEKK3

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_192587.1 Gene:MEKK3 / 826406 AraportID:AT4G08470 Length:560 Species:Arabidopsis thaliana


Alignment Length:523 Identity:140/523 - (26%)
Similarity:228/523 - (43%) Gaps:130/523 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  1118 PEKVAKKKASPRTRKTSSPATSRSRTPTRTPMSAGMVL------------------NPNTPPLQS 1164
            |.|..|:::|..:..||      .:....|..:.||.:                  :.:|..:.|
plant    65 PSKTVKRQSSSSSDNTS------DKEEVETEETRGMFVQLGDTAHEACPFATNEADSSSTVSIIS 123

  Fly  1165 PPY------------NKLLHPQFSLKEDVSGTSYSPVDSSDYVDTPCQRSANGELRLLVP--QTP 1215
            |.|            .|.| .:.||.....|:|.|.|.|    ::.|.        |:.|  :.|
plant   124 PSYASRGSIVPSWLKRKFL-GRVSLGFVYEGSSGSSVGS----ESTCS--------LMTPSLEFP 175

  Fly  1216 P---------TPASPGKSSLESTPLALRQERVRDAVNRLDMDLEDGLRERRLIGQ---------- 1261
            .         :...|.:...|...|. |.:.:.:..|..|::......:.:|:|:          
plant   176 DRISFRKKDFSEKGPSRHVWEKRKLT-RAKLIENFCNPEDIEPVTSWLKGQLLGEESFASVYEAI 239

  Fly  1262 --------------VKSLNSSDKVHIRARSV----------------------HFR-------WH 1283
                          ..|:...|::..|.|..                      :||       |.
plant   240 SDSSVGSESTCSLMTPSMEFPDRISFRKRDFSEEGPSGRVKEKRKLMRNKLIENFRKPEDITSWL 304

  Fly  1284 RGIKIGQGRFGKVYTAVNNNTGELMAMKEIA-----IQPGETRALKNVAEELKILEGIKHKNLVR 1343
            :|..:|:|.:..||.|::.: |:..|:||::     ||..|  .::.:..|:.:|..::|:|:||
plant   305 KGQLLGRGSYASVYEAISED-GDFFAVKEVSLLDKGIQAQE--CIQQLEGEIALLSQLQHQNIVR 366

  Fly  1344 YYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTA 1408
            |.|......:|.||:||.::|:::.|.| ...|...:...:|.|:|:|::.||..|.||||||.|
plant   367 YRGTAKDVSKLYIFLELVTQGSVQKLYE-RYQLSYTVVSLYTRQILAGLNYLHDKGFVHRDIKCA 430

  Fly  1409 NIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVG 1473
            |: |||.:.::||.|||     .|..:...::....||..:|||||..:.:|||:|..|||||:|
plant   431 NM-LVDANGTVKLADFG-----LAEASKFNDIMSCKGTLFWMAPEVINRKDSDGNGSPADIWSLG 489

  Fly  1474 CVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLE 1538
            |.|:||.:|:.|::.. ...|..||:|.|..|..|::||.:...||..||:.:|:.|.||.|||.
plant   490 CTVLEMCTGQIPYSDL-KPIQAAFKIGRGTLPDVPDTLSLDARHFILTCLKVNPEERPTAAELLH 553

  Fly  1539 HNF 1541
            |.|
plant   554 HPF 556

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 101/273 (37%)
S_TKc 1282..1541 CDD:214567 99/263 (38%)
MEKK3NP_192587.1 PKc_like 302..557 CDD:328722 100/266 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48016
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.