DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT3G46140

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_190200.1 Gene:AT3G46140 / 823757 AraportID:AT3G46140 Length:376 Species:Arabidopsis thaliana


Alignment Length:371 Identity:99/371 - (26%)
Similarity:155/371 - (41%) Gaps:80/371 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1215 PPTPASPGKSSLESTPLALRQERVR---------DAVNRLDMDLEDGLRERRLIGQVKSLNSSDK 1270
            ||.|......:|:.:|:.|:..:.:         .:|..:...:.||:                 
plant    42 PPLPDQNPIFTLKLSPIILKNNKRKRFTPKSSSSRSVEEITKQVFDGV----------------- 89

  Fly  1271 VHIRARSVHFRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEG 1335
              :|..|   .|.:...:|:|.:|.||.|.:........|   ||:..|.....::.:|.:||..
plant    90 --VRKSS---SWIKSEFLGRGSYGSVYLATSKKAKTKTTM---AIKSAEISRASSLMDEERILTR 146

  Fly  1336 IKHKNLVRYYGIEVHREELL---------IFMELCSEGTLESLV-ELTGNLPEALTRRFTAQLLS 1390
            :....:||.||.|:.|||.|         :.:|.||..:|..|| :..|.|.|...:.....:|.
plant   147 LSSPFIVRCYGHEIAREETLFGGERTNYNLILEYCSGKSLFDLVNDNLGGLSEKDVKLLARDILY 211

  Fly  1391 GVSELHKHGIVHRDIKTANIFLVDGSNSL-------KLGDFGSAV--------KIQAHTTVPGEL 1440
            |:..:|:..|:|.|||..||||....|.:       |:||||.|:        |...|..     
plant   212 GLDCIHRANIIHCDIKPENIFLTPVENRIRPSGYVAKIGDFGLALEKGSSEYEKASGHRR----- 271

  Fly  1441 QGYVGTQAYMAPEVFTKTNSDGHG---RAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMG 1502
                ||..||:||:..      ||   .|.|.|:.||.|:||.:|::.|.:......:.:.:.:|
plant   272 ----GTTRYMSPELIR------HGIVDYAVDTWAFGCTVLEMLTGQQVWGEHSDLGSVDWDILIG 326

  Fly  1503 EK---PQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCKYG 1545
            :.   |..|:.||:|...|:..||:.||..|.....||.|.|.:.|
plant   327 QSCYIPYIPDWLSEEAQHFLSRCLKRDPASRWGIGALLNHPFLQCG 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 86/291 (30%)
S_TKc 1282..1541 CDD:214567 86/289 (30%)
AT3G46140NP_190200.1 STKc_MAPKKK 95..369 CDD:270783 86/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.