DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and NP3

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_187254.1 Gene:NP3 / 819774 AraportID:AT3G06030 Length:651 Species:Arabidopsis thaliana


Alignment Length:336 Identity:128/336 - (38%)
Similarity:181/336 - (53%) Gaps:35/336 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1239 RDAVNRLDMDLEDGLRERRLIGQVKSLNSSDKVHIRARSV-------------------HFRWHR 1284
            |..|.|..:..:||.....|.|.|..:|||    ||:..:                   ..||.:
plant    10 RSLVFRSSLAGDDGTSGGGLSGFVGKINSS----IRSSRIGLFSKPPPGLPAPRKEEAPSIRWRK 70

  Fly  1285 GIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRA------LKNVAEELKILEGIKHKNLVR 1343
            |..||.|.||:||..:|.::|||:|:|::.|.|.....      ::.:.||:::|:.:.|.|:||
plant    71 GELIGCGAFGRVYMGMNLDSGELLAIKQVLIAPSSASKEKTQGHIRELEEEVQLLKNLSHPNIVR 135

  Fly  1344 YYGIEVHREELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTA 1408
            |.|.....:.|.|.||....|::.||:|..|:.||.:...:|.|||.|:..||.:||:|||||.|
plant   136 YLGTVRESDSLNILMEFVPGGSISSLLEKFGSFPEPVIIMYTKQLLLGLEYLHNNGIMHRDIKGA 200

  Fly  1409 NIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVG 1473
            || |||....::|.|||::.|:....||.| .:...||..:|||||..:|   ||..:|||||||
plant   201 NI-LVDNKGCIRLADFGASKKVVELATVNG-AKSMKGTPYWMAPEVILQT---GHSFSADIWSVG 260

  Fly  1474 CVVVEMASGKRPWAQFDSNFQIMFKVGMGE-KPQAPESLSQEGHDFIDHCLQHDPKRRLTAVELL 1537
            |.|:|||:||.||::....|..:..:|..: .|..||.||.|..||:..||..:|..||:|.|||
plant   261 CTVIEMATGKPPWSEQYQQFAAVLHIGRTKAHPPIPEDLSPEAKDFLMKCLHKEPSLRLSATELL 325

  Fly  1538 EHNFCKYGRDE 1548
            :|.|....|.|
plant   326 QHPFVTGKRQE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 112/267 (42%)
S_TKc 1282..1541 CDD:214567 111/265 (42%)
NP3NP_187254.1 STKc_MAPKKK 67..330 CDD:270783 112/267 (42%)
S_TKc 68..330 CDD:214567 111/266 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 209 1.000 Domainoid score I802
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2506
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.