DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT2G42550

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_181783.1 Gene:AT2G42550 / 818855 AraportID:AT2G42550 Length:344 Species:Arabidopsis thaliana


Alignment Length:271 Identity:79/271 - (29%)
Similarity:136/271 - (50%) Gaps:25/271 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1290 QGRFGKV----YTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKH-KNLVRYYGIEV 1349
            :|.:|.|    |...::|...|.|    |::..|.....::..|::||..::. :.:|:.||...
plant    13 KGAYGSVDLVKYIKRDDNALPLYA----AVKTAECEDYNSLEREIQILSKLEGCRRIVQCYGNYT 73

  Fly  1350 HREEL--------LIFMELCSEGTLESLVE--LTGNLPEALTRRFTAQLLSGVSELHKHGIVHRD 1404
            ..|:.        .:.||..:.|:|.|.::  ....|||.:.:.||..:|.|:..:|:.|.||.|
plant    74 LEEDFDVGGFRVYKMVMEYAAAGSLFSFMDSYKDRKLPETMIKDFTRMILQGLVSVHRLGYVHCD 138

  Fly  1405 IKTAN--IFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAA 1467
            :|..|  :|....|..||:.||||:.|:..::........:|||..||:||   ...|....:|.
plant   139 LKPDNLLVFPCRQSYELKISDFGSSRKVGEYSDCWDVDLPFVGTPVYMSPE---SVRSGVAEKAL 200

  Fly  1468 DIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFIDHCLQHDPKRRLT 1532
            |:||:||:|:||.:|..||::.:.. .:...:..|:.|:.|:||..:...|::.|...:||.|.:
plant   201 DLWSLGCIVLEMYTGVIPWSEVEFE-DLAPALSKGKAPEIPKSLPCDARKFLETCFSRNPKERGS 264

  Fly  1533 AVELLEHNFCK 1543
            |.:||.|.|.:
plant   265 ASDLLSHQFLR 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 78/268 (29%)
S_TKc 1282..1541 CDD:214567 78/267 (29%)
AT2G42550NP_181783.1 PKc_like 9..274 CDD:419665 78/268 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.