DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT2G41930

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_850360.2 Gene:AT2G41930 / 818793 AraportID:AT2G41930 Length:351 Species:Arabidopsis thaliana


Alignment Length:306 Identity:88/306 - (28%)
Similarity:150/306 - (49%) Gaps:53/306 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1288 IGQGRFGKV-YTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIK---------HKNLV 1342
            :|:|.:|.| ..:...|.|.|: ...:.|...|...  ::.:|.:||..::         ..:||
plant    11 LGKGTYGSVELFSHKQNDGSLL-YNAVKIMDSENYG--SIDQEFRILSELRGCPCIVQLCGNSLV 72

  Fly  1343 RYYGIEVHREEL-LIFMELCSEGTLESLVELT-GNLPEALTRRFTAQLLSGVSELHKHGIVHRDI 1405
            :  ||:.:.::: ::.||..:.|||.:.::.. ..|.:::.:.||..:|.|:..:|.||.||.|:
plant    73 Q--GIDCNGKKVYMMSMEYAAAGTLTNFIKRNRTKLSDSVIKDFTRMILQGLVSIHNHGYVHCDL 135

  Fly  1406 KTANIFLV--------DGSNSLKLGDFGSAVKIQAHTTVPGELQG-------YVGTQAYMAPEVF 1455
            |..||.|.        :.|..||:.|||.       :|..|:..|       :|||..||:||  
plant   136 KPDNILLFPLYDKDTWNCSYELKISDFGI-------STRAGDKSGCWRVDEPWVGTSIYMSPE-- 191

  Fly  1456 TKTNSDGH--GRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEK-PQAPESLSQEGHD 1517
              :.|||.  .:..|:||:||:|::|.:|||||..|:.:.:.:.   :.:| |:.||:|..:...
plant   192 --SVSDGTTVEKTLDLWSLGCIVLKMYTGKRPWLGFEKDVKSLL---LNQKAPEIPETLPCDARL 251

  Fly  1518 FIDHCLQHDPKRRLTAVELLEHNFC----KYGRDECSSEQLQMQVR 1559
            |::.|....|:.|.:|.|||.|.|.    |.|......|:..|.:|
plant   252 FLEKCFSRKPEERGSASELLLHPFLTGDEKKGSSVAGGERTGMVLR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 82/283 (29%)
S_TKc 1282..1541 CDD:214567 82/282 (29%)
AT2G41930NP_850360.2 S_TKc 6..276 CDD:214567 82/283 (29%)
PKc_like 9..276 CDD:304357 82/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.