DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT2G41920

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_181723.1 Gene:AT2G41920 / 818792 AraportID:AT2G41920 Length:318 Species:Arabidopsis thaliana


Alignment Length:299 Identity:82/299 - (27%)
Similarity:137/299 - (45%) Gaps:46/299 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1289 GQGRFGKV--YTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKH-KNLVRYYG---I 1347
            |:..||.|  :.......||   .:..|::.......|::.:|.:||...|. ..:|:.||   .
plant    13 GERSFGSVSLFKYKRQRDGE---TQYAAVKTSSDENAKSLYKEFQILSQFKGCSRIVQCYGNGVK 74

  Fly  1348 EVHRE----ELLIFMELCSEGTLESLVE--LTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIK 1406
            |:..:    |..|.||....|:|...::  ....|.:::.|.||..||.|::.:|:||.||.|:|
plant    75 EIFNDKGYVEYKIAMEYAFGGSLSDFMDRFKDRKLSDSMIREFTRMLLEGLATIHRHGYVHCDLK 139

  Fly  1407 TANIFLVDG----------SNSLKLGDFGSAVKIQAHTTVPGELQ------GYVGTQAYMAPEVF 1455
            ..||.:...          |..||:.|||.:.:       .|:.|      .||||..||:||  
plant   140 PENILVFPSSVYKNGAWIRSYELKISDFGMSKR-------DGDTQWWQPRKPYVGTPIYMSPE-- 195

  Fly  1456 TKTNSDGH-GRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFI 1519
              :.|.|. |:..|:||:||||:||.:.|:||...:...:.:.|.   .:|..|.:|..:...|:
plant   196 --SISHGEIGKGLDLWSLGCVVLEMYTRKKPWWHTNYELEELMKC---YEPLFPRNLPCDAKLFL 255

  Fly  1520 DHCLQHDPKRRLTAVELLEHNFCKYGRDECSSEQLQMQV 1558
            ..|...:|..|..|:.||..:|.....::.::.|:.:::
plant   256 MTCFASEPDERKDALTLLRQSFLHGDVNKFTNRQMNVKI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 80/281 (28%)
S_TKc 1282..1541 CDD:214567 80/280 (29%)
AT2G41920NP_181723.1 PKc_like 13..278 CDD:304357 80/281 (28%)
S_TKc 13..278 CDD:214567 80/281 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.