DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT2G40580

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_181590.1 Gene:AT2G40580 / 818653 AraportID:AT2G40580 Length:311 Species:Arabidopsis thaliana


Alignment Length:310 Identity:89/310 - (28%)
Similarity:129/310 - (41%) Gaps:74/310 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1291 GRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKN--LVRYYGIEVH--- 1350
            |.||.|....::|.|:....|...::..     ||:.:||:|:... |.|  :||.....:|   
plant    22 GTFGFVSLQSDSNLGKSYVKKTSTLEQS-----KNLEKELRIMLRF-HNNPFIVRASSDHLHFAT 80

  Fly  1351 ----REELLIFMELCSEGTLESLV-ELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANI 1410
                .....|:||..|.|.|..:: :..|.|.|...||.|..:|.|:..||..|.||.|:|.:|:
plant    81 NTKSMSLCYIYMEYASLGNLNKMISDAGGRLSEDSVRRATRMILQGLKALHSEGFVHCDLKPSNV 145

  Fly  1411 FLVDGSNS------LKLGDFGSAVK--IQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGH---- 1463
             ||..||:      |||..||.:.:  :.:....||.|      :.||:||...:....|.    
plant   146 -LVFPSNTRGEPWDLKLAGFGLSKEPTMDSSLLFPGTL------EEYMSPEAIERDRFVGKDKLI 203

  Fly  1464 GRAADIWSVGCVVVEM-------ASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFIDH 1521
            |.|.||||:|.:|:.|       ..|...|..:                   |.:|.|..||:..
plant   204 GPARDIWSLGRIVLRMFGGIPVEVRGSNTWRLY-------------------EDISPEATDFVRR 249

  Fly  1522 CLQHDPKRRLTAVELLEHNFCKYGRDECSSEQLQ-----MQVRGSFRRNV 1566
            ||...|..|.|..|||:|.|        ::|:|.     ::|....||||
plant   250 CLAWRPSNRATVDELLDHPF--------AAEKLPLLLSFLRVPSFVRRNV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 81/279 (29%)
S_TKc 1282..1541 CDD:214567 81/278 (29%)
AT2G40580NP_181590.1 S_TKc 13..269 CDD:214567 81/278 (29%)
PKc_like 17..269 CDD:304357 81/278 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.