DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT2G34290

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_180976.1 Gene:AT2G34290 / 817990 AraportID:AT2G34290 Length:265 Species:Arabidopsis thaliana


Alignment Length:282 Identity:88/282 - (31%)
Similarity:131/282 - (46%) Gaps:53/282 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly  1288 IGQGRFGKV--------------YTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKH 1338
            :|:|.||.|              |.||..:..                 .|::.||.:||...|.
plant     7 LGEGSFGSVSLFSYKRRCDVETLYAAVKTSDD-----------------AKSLYEEFQILSKFKG 54

  Fly  1339 -KNLVRYYGIEVHRE-------ELLIFMELCSEGTLESLVELTGN--LPEALTRRFTAQLLSGVS 1393
             ..:|:.||..|.:.       |..|.||..:.|:|...::...:  ||:.:.|:||..||.|::
plant    55 CSRIVQCYGSGVEQRLNDKGYVEYTIPMEYAAGGSLSDFMDRFNDKKLPDPMIRKFTRMLLEGLA 119

  Fly  1394 ELHKHGIVHRDIKTANIFLVDGS---NSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVF 1455
            .:|:||.||.|:|..||.:..||   ..||:.|||.: |....||....|:.|.||..||:||  
plant   120 TIHRHGYVHCDLKPENILVFPGSVCDLKLKISDFGLS-KRDGDTTWWHPLKSYAGTPIYMSPE-- 181

  Fly  1456 TKTNSDGH-GRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFI 1519
              :.|.|. |:..|:||:||||:||.:|||||...:...:.:.|.   .:|..|.:|..:...|:
plant   182 --SISHGEIGKGLDLWSLGCVVLEMYTGKRPWWHTNYELEDLMKC---YEPLFPPNLPCDAKLFL 241

  Fly  1520 DHCLQHDPKRRLTAVELLEHNF 1541
            ..|...:|..|..|:.||..:|
plant   242 MTCFAPEPDERKDALTLLRQSF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 88/282 (31%)
S_TKc 1282..1541 CDD:214567 87/280 (31%)
AT2G34290NP_180976.1 STKc_MAPKKK 5..264 CDD:270783 88/282 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.