DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and MAPKKK17

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_180810.1 Gene:MAPKKK17 / 817812 AraportID:AT2G32510 Length:372 Species:Arabidopsis thaliana


Alignment Length:270 Identity:86/270 - (31%)
Similarity:138/270 - (51%) Gaps:24/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly  1282 WHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYG 1346
            |.||..:|:|....||.|..:|:.|::|:|...:...|.     :..|.|||..:....::.|.|
plant     3 WTRGRILGRGSTATVYAAAGHNSDEILAVKSSEVHRSEF-----LQREAKILSSLSSPYVIGYRG 62

  Fly  1347 IEVHREE-----LLIFMELCSEGTL-ESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDI 1405
            .|..||.     ..:.||....||| ::..:..|.:.|....::|..:|.|:..:|..||||.|:
plant    63 SETKRESNGVVMYNLLMEYAPYGTLTDAAAKDGGRVDETRVVKYTRDILKGLEYIHSKGIVHCDV 127

  Fly  1406 KTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIW 1470
            |.:|: ::......|:.|||.|.::......|     .:||.|:|||||   ...:..|:.:|||
plant   128 KGSNV-VISEKGEAKIADFGCAKRVDPVFESP-----VMGTPAFMAPEV---ARGEKQGKESDIW 183

  Fly  1471 SVGCVVVEMASGKRPWAQFDSN---FQIMFKVG-MGEKPQAPESLSQEGHDFIDHCLQHDPKRRL 1531
            :|||.::||.:|..||.:.||.   ..::::|| ..|.|:.|..|::|..||::.||:.:...|.
plant   184 AVGCTMIEMVTGSPPWTKADSREDPVSVLYRVGYSSETPELPCLLAEEAKDFLEKCLKREANERW 248

  Fly  1532 TAVELLEHNF 1541
            ||.:||.|.|
plant   249 TATQLLNHPF 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 86/270 (32%)
S_TKc 1282..1541 CDD:214567 85/268 (32%)
MAPKKK17NP_180810.1 STKc_MAPKKK 2..259 CDD:270783 86/270 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.