DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and MAPKKK14

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_180565.1 Gene:MAPKKK14 / 817555 AraportID:AT2G30040 Length:463 Species:Arabidopsis thaliana


Alignment Length:309 Identity:104/309 - (33%)
Similarity:164/309 - (53%) Gaps:37/309 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1253 LRERRLIGQVKSLNSSDKVHIRARSVHFRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQ- 1316
            :.::.:|....|.:||             |.||..:|:|.||.|..|::...|.|.|:|.|.:. 
plant     1 MEKQNIISNTSSSSSS-------------WIRGSCVGRGCFGTVSKALSKIDGGLFAVKSIDLAT 52

  Fly  1317 --PGETRALKNVAEELKILEGIK-HKNLVRYYGIEVHREELLIFMELCSEGTLESLVELTGNLPE 1378
              |.:..:|:|   |:.||..:| |.|:||:.|.:|.:|....|..|..|.:.|..|...|.:.|
plant    53 CLPSQAESLEN---EIVILRSMKSHPNIVRFLGDDVSKEGTASFRNLHLEYSPEGDVANGGIVNE 114

  Fly  1379 ALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQGY 1443
            .|.||:...|:|.:|.:|.:||||.|:|:.|:.:.:|.:|:||.||||||:.:..|.       :
plant   115 TLLRRYVWCLVSALSHVHSNGIVHCDVKSKNVLVFNGGSSVKLADFGSAVEFEKSTI-------H 172

  Fly  1444 V---GTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVGM-GEK 1504
            |   |:..:|||||..:   :..|..:|:||:||.|:||.:||..|.  |..|..:.::|. .:.
plant   173 VSPRGSPLWMAPEVVRR---EYQGPESDVWSLGCTVIEMLTGKPAWE--DHGFDSLSRIGFSNDL 232

  Fly  1505 PQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNF-CKYGRDECSSE 1552
            |..|..||:.|.||::.||:.|..:|.:..:||:|.| |:...|...:|
plant   233 PFIPVGLSELGRDFLEKCLKRDRSQRWSCDQLLQHPFLCQDHHDSFFTE 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 97/269 (36%)
S_TKc 1282..1541 CDD:214567 96/266 (36%)
MAPKKK14NP_180565.1 STKc_MAPKKK 17..270 CDD:270783 96/267 (36%)
S_TKc 17..270 CDD:214567 96/267 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.