DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and AT2G05060

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_178581.1 Gene:AT2G05060 / 815054 AraportID:AT2G05060 Length:315 Species:Arabidopsis thaliana


Alignment Length:269 Identity:84/269 - (31%)
Similarity:131/269 - (48%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1303 NTGELMAMKEIAIQPGET--RALK--------NVAEELKILEGIKH-KNLVRYYGIEVHRE---- 1352
            ::|.:..:|..:...|:|  .|:|        ::.:|.:||...|. ..:|:.||.:|...    
plant    24 SSGSVSLIKYKSRLDGQTLYAAVKTSNIIHADSLLKEFQILSEFKGCSRIVQCYGTKVQETINEE 88

  Fly  1353 ---ELLIFMELCSEGTLESLVELTGN--LPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFL 1412
               |..|.||..|.|:|...:....:  ||:||.||||..:|.|::.:|.||.||.|:|..|| |
plant    89 GDVEFTIPMEYASGGSLRHFMSRFKDMKLPDALIRRFTRMILEGLAVIHGHGYVHCDLKPENI-L 152

  Fly  1413 VDGSNSLKLGDFGSAVK-------IQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGH-GRAADI 1469
            |..|..||:.|||.:.:       :.:|.        :.||..||:||    :.|:|. .|..|:
plant   153 VFPSFELKISDFGLSKREGDSKWWLPSHP--------FAGTPVYMSPE----SISNGETRRGLDL 205

  Fly  1470 WSVGCVVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFIDHCLQHDPKRRLTAV 1534
            ||:||||:||.:|||||  :|.|:. :..:..|..|...:.:..:...|:..|...:..:|..|.
plant   206 WSLGCVVLEMYTGKRPW--WDKNYD-LGDLKKGSMPLISKDIPCDAKLFVMTCFASETNKRKNAF 267

  Fly  1535 ELLEHNFCK 1543
            .||.|.|.:
plant   268 TLLRHCFLR 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 83/266 (31%)
S_TKc 1282..1541 CDD:214567 83/265 (31%)
AT2G05060NP_178581.1 S_TKc 15..272 CDD:214567 82/263 (31%)
STKc_MAPKKK 18..275 CDD:270783 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.