DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and hpo

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:300 Identity:94/300 - (31%)
Similarity:149/300 - (49%) Gaps:30/300 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1287 KIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYGIEVHR 1351
            |:|:|.:|.||.||:..:..::|:|.:.::..    |..:.:|:.|::......:|||||....:
  Fly    47 KLGEGSYGSVYKAVHKESSSIVAIKLVPVESD----LHEIIKEISIMQQCDSPYVVRYYGSYFKQ 107

  Fly  1352 EELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLS----GVSELHKHGIVHRDIKTANIFL 1412
            .:|.|.||.|..|::..::.|.   .:.||....|.:||    |:..||....:|||||.||| |
  Fly   108 YDLWICMEYCGAGSVSDIMRLR---KKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANI-L 168

  Fly  1413 VDGSNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVV 1477
            ::.....||.|||.|.::   |....:....:||..:|||||..:.   |:...|||||:|...:
  Fly   169 LNTEGYAKLADFGVAGQL---TDTMAKRNTVIGTPFWMAPEVIEEI---GYDCVADIWSLGITAL 227

  Fly  1478 EMASGKRPWAQFDSNFQIMFKVGMGEKP--QAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHN 1540
            |||.||.|:.:... .:.:|.:.....|  :.|:..|.|..||:..||..:|..|.||.|||||.
  Fly   228 EMAEGKPPYGEIHP-MRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHE 291

  Fly  1541 FCKYGR---------DECSSEQLQMQVRGSFRRNVATSSS 1571
            |.:..:         :|..:.:.|.:...||...:|.|.:
  Fly   292 FIRNAKHRSILKPMLEETCAIREQQRANRSFGGVLAASQA 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 87/260 (33%)
S_TKc 1282..1541 CDD:214567 87/259 (34%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 87/260 (33%)
S_TKc 42..293 CDD:214567 87/260 (33%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.