DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and Stk4

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001101270.1 Gene:Stk4 / 311622 RGDID:1312035 Length:487 Species:Rattus norvegicus


Alignment Length:260 Identity:85/260 - (32%)
Similarity:135/260 - (51%) Gaps:15/260 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly  1287 KIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYGIEVHR 1351
            |:|:|.:|.||.|::..||:::|:|::.::..    |:.:.:|:.|::.....::|:|||.....
  Rat    35 KLGEGSYGSVYKAIHKETGQIVAIKQVPVESD----LQEIIKEISIMQQCDSPHVVKYYGSYFKN 95

  Fly  1352 EELLIFMELCSEGTLESLVELTG-NLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDG 1415
            .:|.|.||.|..|::..::.|.. .|.|..........|.|:..||....:|||||..|| |::.
  Rat    96 TDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNI-LLNT 159

  Fly  1416 SNSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMA 1480
            ....||.|||.|.::   |....:....:||..:|||||..:.   |:...|||||:|...:|||
  Rat   160 EGHAKLADFGVAGQL---TDTMAKRNTVIGTPFWMAPEVIQEI---GYNCVADIWSLGITAIEMA 218

  Fly  1481 SGKRPWAQFDSNFQIMFKVGMGEKP--QAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCK 1543
            .||.|:|.... .:.:|.:.....|  :.||..|....||:..||...|::|.||.:||:|.|.|
  Rat   219 EGKPPYADIHP-MRAIFMIPTNPPPTFRKPEVWSDNFMDFVKQCLVKSPEQRATATQLLQHPFVK 282

  Fly  1544  1543
              Rat   283  282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 83/257 (32%)
S_TKc 1282..1541 CDD:214567 83/256 (32%)
Stk4NP_001101270.1 STKc_MST1_2 26..281 CDD:132943 83/257 (32%)
Mst1_SARAH 433..480 CDD:402983
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.