DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and Map3k3

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_001100528.1 Gene:Map3k3 / 303604 RGDID:1304575 Length:626 Species:Rattus norvegicus


Alignment Length:493 Identity:147/493 - (29%)
Similarity:237/493 - (48%) Gaps:87/493 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1086 PQITQHLD--------DDEFEALKQQMDRCI-----SHVIGITSEPEKVAKKKASPRTRKTSSPA 1137
            |:..||:.        :.|.|.:.:..::|:     |....::...:.:.:...||..|| |..:
  Rat   183 PERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSFRK-SQMS 246

  Fly  1138 TSRSRTPTRTPMSAGMVLNPNTPPLQSPPYNKLLHPQFSLKEDVSGTSYS-----PVDSSDYVD- 1196
            .:||....|...|          ..::..|:|          .|.|.:|.     .|...||.| 
  Rat   247 RARSFPDNRKECS----------DRETQLYDK----------GVKGGTYPRRYHVSVHHKDYNDG 291

  Fly  1197 ---TPCQRSANGELRLLVPQTPPTPASPGKSSLESTPLALRQERVRDAVNRLDMDLEDGLRERRL 1258
               .|..|...|.|..|||              .|..|:...|.:..||..||..          
  Rat   292 RRTFPRIRRHQGNLFTLVP--------------SSRSLSTNGENMGAAVQYLDPR---------- 332

  Fly  1259 IGQVKSLNSSDKVHIRARSV-------HFRWHRGIKIGQGRFGKVYTAVNNNTGELMAMKEIAIQ 1316
             |:::|.:|.:.:.::.|||       ...|.||..:|||.||:||...:.:||..:|.|::...
  Rat   333 -GRLRSADSENALTVQERSVPTKSPSAPINWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFD 396

  Fly  1317 PGETRALKNVAE---ELKILEGIKHKNLVRYYGIEVHREE--LLIFMELCSEGTLESLVELTGNL 1376
            |......|.|:.   |:::|:.::|:.:|:|||....|.|  |.||||....|:::..::..|.|
  Rat   397 PDSPETSKEVSALECEIQLLKNLQHERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGAL 461

  Fly  1377 PEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGSNSLKLGDFGSAVKIQAHTTVPGELQ 1441
            .|::||::|.|:|.|:|.||.:.|||||||.||| |.|.:.::||||||::.::|........::
  Rat   462 TESVTRKYTRQILEGMSYLHSNMIVHRDIKGANI-LRDSAGNVKLGDFGASKRLQTICMSGTGMR 525

  Fly  1442 GYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMASGKRPWAQFDSNFQIMFKVG-MGEKP 1505
            ...||..:|:|||.   :.:|:||.||:||:||.||||.:.|.|||:::: ...:||:. ....|
  Rat   526 SVTGTPYWMSPEVI---SGEGYGRKADVWSLGCTVVEMLTEKPPWAEYEA-MAAIFKIATQPTNP 586

  Fly  1506 QAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNFCK 1543
            |.|..:|:.|.||:..... :.::|.:|.|||.|:|.:
  Rat   587 QLPSHISEHGRDFLRRIFV-EARQRPSAEELLTHHFAQ 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 101/266 (38%)
S_TKc 1282..1541 CDD:214567 101/264 (38%)
Map3k3NP_001100528.1 PB1_Mekk2_3 45..123 CDD:99726
STKc_MEKK3_like 361..621 CDD:270795 101/265 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D55144at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.