DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and sid1

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_593564.1 Gene:sid1 / 2542746 PomBaseID:SPAC9G1.09 Length:471 Species:Schizosaccharomyces pombe


Alignment Length:262 Identity:90/262 - (34%)
Similarity:145/262 - (55%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1287 KIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYGIEVHR 1351
            |:|.|.||.|:.|..|.:|:::|:|:|.::.| ...:.::.:|:.:|......|:::|||..|..
pombe    14 KLGSGSFGVVWKARENVSGDIIAIKQIDLETG-IDDITDIEQEVFMLSNCNSSNVIQYYGCFVDG 77

  Fly  1352 EELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGS 1416
            ..|.|.||....|::..|::: |.|.|.:......::|.|::.||....:|||||.|||.|...:
pombe    78 YTLWILMEHMDGGSVSGLLKM-GRLNEQVISIILREVLYGLNYLHGQNKIHRDIKAANILLSSST 141

  Fly  1417 NSLKLGDFGSAVKI-----QAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVV 1476
            .::||.|||.|.::     :.||        :|||..:|||||..:|:   :|.||||||:|...
pombe   142 GNVKLADFGVAAQLSNAASRRHT--------FVGTPFWMAPEVIQQTS---YGLAADIWSLGITA 195

  Fly  1477 VEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPESLSQEGHDFIDHCLQHDPKRRLTAVELLEHNF 1541
            :|||:|..|.|.... .:::|::...|.|:..:..|....||:..||..:|..|.:|.|||:|.|
pombe   196 IEMANGIPPRATMHP-MRVIFEIPQSEPPKLDDHFSPTFRDFVSCCLDLNPNMRWSAKELLQHPF 259

  Fly  1542 CK 1543
            .|
pombe   260 IK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 88/259 (34%)
S_TKc 1282..1541 CDD:214567 88/258 (34%)
sid1NP_593564.1 STKc_MST3_like 7..279 CDD:270786 90/262 (34%)
S_TKc 9..260 CDD:214567 88/259 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.