DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and ppk11

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:NP_594517.1 Gene:ppk11 / 2541473 PomBaseID:SPAC2C4.14c Length:312 Species:Schizosaccharomyces pombe


Alignment Length:265 Identity:84/265 - (31%)
Similarity:136/265 - (51%) Gaps:26/265 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1288 IGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYGIEVHRE 1352
            ||||.||.|:.|.:..:.:::|:|.:.:...:.: ::.:.:|:..|..:...::.:||...|...
pombe    12 IGQGSFGSVFRAQDVESSKIVALKVVDLDATKDQ-IETLTQEINFLIDLNSVHITKYYASFVDGF 75

  Fly  1353 ELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIF-LVDGS 1416
            .|.|.||.|..|:...|::|:|...|.:......|:|..:..||..|.:|||||.|||. :.|| 
pombe    76 RLWITMEYCDGGSCLDLLKLSGTFSERVIAEVMRQVLEALVYLHGQGKMHRDIKAANILTMKDG- 139

  Fly  1417 NSLKLGDFGSAVKIQAHTTVPGELQG-------YVGTQAYMAPEVFTKTNSDGHGRAADIWSVGC 1474
             .:||.|||          |.|:|:.       :|||..:|||||..:|   |:...|||||:|.
pombe   140 -LVKLADFG----------VSGQLESLRDKNDDFVGTPFWMAPEVVKQT---GYNYKADIWSLGI 190

  Fly  1475 VVVEMASGKRPWAQFDSNFQIMFKVGMGEKPQAPES-LSQEGHDFIDHCLQHDPKRRLTAVELLE 1538
            ...|:|:|:.|::.... .:::..:.....|....| .|:...||:.:||:.:||.|.||..|.:
pombe   191 TAYELATGEPPYSGIHP-MKVLLLIPKHSPPSLERSKFSRAFCDFVSNCLKKNPKDRATAEYLSK 254

  Fly  1539 HNFCK 1543
            |.|.|
pombe   255 HKFIK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 82/262 (31%)
S_TKc 1282..1541 CDD:214567 82/261 (31%)
ppk11NP_594517.1 STKc_MST3_like 4..278 CDD:270786 84/265 (32%)
S_TKc 6..258 CDD:214567 82/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.