DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mekk1 and MAP4K1

DIOPT Version :9

Sequence 1:NP_732373.1 Gene:Mekk1 / 42253 FlyBaseID:FBgn0024329 Length:1571 Species:Drosophila melanogaster
Sequence 2:XP_011524705.1 Gene:MAP4K1 / 11184 HGNCID:6863 Length:873 Species:Homo sapiens


Alignment Length:260 Identity:83/260 - (31%)
Similarity:147/260 - (56%) Gaps:17/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1287 KIGQGRFGKVYTAVNNNTGELMAMKEIAIQPGETRALKNVAEELKILEGIKHKNLVRYYGIEVHR 1351
            ::|.|.:|:|:.|.:..:|:|:|:|.:.::|.:.  :..:.:|:.||:..:|.|:|.|:|..:..
Human    22 RLGGGTYGEVFKARDKVSGDLVALKMVKMEPDDD--VSTLQKEILILKTCRHANIVAYHGSYLWL 84

  Fly  1352 EELLIFMELCSEGTLESLVELTGNLPEALTRRFTAQLLSGVSELHKHGIVHRDIKTANIFLVDGS 1416
            ::|.|.||.|..|:|:.:.::||:|.|........::|.|::.||....:|||||.||| |::.:
Human    85 QKLWICMEFCGAGSLQDIYQVTGSLSELQISYVCREVLQGLAYLHSQKKIHRDIKGANI-LINDA 148

  Fly  1417 NSLKLGDFGSAVKIQAHTTVPGELQGYVGTQAYMAPEVFTKTNSDGHGRAADIWSVGCVVVEMAS 1481
            ..::|.|||.:.:|.|  |:...| .::||..:|||||.......|:....||||:|...:|:|.
Human   149 GEVRLADFGISAQIGA--TLARRL-SFIGTPYWMAPEVAAVALKGGYNELCDIWSLGITAIELAE 210

  Fly  1482 GKRPWAQFDSN-FQIMFKVGMGEKPQAPESLSQEG------HDFIDHCLQHDPKRRLTAVELLEH 1539
            .:.|  .||.: .:::|.  |.:....|..|.::|      |:||...|...||:|.:|.::|.|
Human   211 LQPP--LFDVHPLRVLFL--MTKSGYQPPRLKEKGKWSAAFHNFIKVTLTKSPKKRPSATKMLSH 271

  Fly  1540  1539
            Human   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mekk1NP_732373.1 STKc_MEKK4 1281..1542 CDD:270796 83/260 (32%)
S_TKc 1282..1541 CDD:214567 83/260 (32%)
MAP4K1XP_011524705.1 STKc_MAP4K3_like 16..274 CDD:270788 83/260 (32%)
S_TKc 17..274 CDD:214567 83/260 (32%)
CNH 540..847 CDD:214481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.