DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP1B and tld

DIOPT Version :9

Sequence 1:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens
Sequence 2:NP_524487.2 Gene:tld / 42945 FlyBaseID:FBgn0003719 Length:1067 Species:Drosophila melanogaster


Alignment Length:811 Identity:178/811 - (21%)
Similarity:267/811 - (32%) Gaps:291/811 - (35%)


- Green bases have known domain annotations that are detailed below.


Human    61 RNSIIGEKYR-WPH-TIPYVLEDSLEMNAKGVILNAFERYRLKTCIDF--KPWAGETNYI-SVFK 120
            |.::...|.| |.: .|||.::.......|.:...|...:...|||.|  :......||| ...|
  Fly   135 RRAVTVRKERTWDYGVIPYEIDTIFSGAHKALFKQAMRHWENFTCIKFVERDPNLHANYIYFTVK 199

Human   121 GSGCWSSVGNRRVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGRE 185
            ..||.|.:|....|:|.:|||.||::...:.||..|.:||.||.:|.|||.::.|....|:.|:|
  Fly   200 NCGCCSFLGKNGNGRQPISIGRNCEKFGIIIHELGHTIGFHHEHARGDRDKHIVINKGNIMRGQE 264

Human   186 HNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRI-----SDFEDVIGQRMDFSDSD 245
            :||:..|.:..|...:|||..|:|||:|.:|........:|.|     :..|  :|||...|..|
  Fly   265 YNFDVLSPEEVDLPLLPYDLNSIMHYAKNSFSKSPYLDTITPIGIPPGTHLE--LGQRKRLSRGD 327

Human   246 LLKLNQLYNCSSSLSFMDSCSFELENVCGMI--QSSGDNADWQRVSQVPRGPESDHSNMGQCQGS 308
            :::.|.||.|:|               ||..  |:||....       |....|.:..:.:.:||
  Fly   328 IVQANLLYKCAS---------------CGRTYQQNSGHIVS-------PHFIYSGNGVLSEFEGS 370

Human   309 G-------FFMHFDSSSVNV--------GATAVLESRTLYPKRGFQCLQFYLY------------ 346
            |       ....||:|..|.        |...:|..:.|:......|.|.||.            
  Fly   371 GDAGEDPSAESEFDASLTNCEWRITATNGEKVILHLQQLHLMSSDDCTQDYLEIRDGYWHKSPLV 435

Human   347 -----NSGSE------SDQLNIYIREYSADN-----------VDGNLTLVEEIKEIPTGSWQL-- 387
                 |...|      |..|..|:...:|..           ..|:|.|.:: :.|.:.::.:  
  Fly   436 RRICGNVSGEVITTQTSRMLLNYVNRNAAKGYRGFKARFEVVCGGDLKLTKD-QSIDSPNYPMDY 499

Human   388 -------YHVTL----KVTKKFRVVFEGRKGSGASLGGLSIDDINLSETR-----C----PHHI- 431
                   :.:|.    :|..||: .||..|..|.:...:.|.|.|.|::|     |    |.:| 
  Fly   500 MPDKECVWRITAPDNHQVALKFQ-SFELEKHDGCAYDFVEIRDGNHSDSRLIGRFCGDKLPPNIK 563

Human   432 -----WHIR-----------------------NFTQF---------IGS---------------- 443
                 .:||                       .||..         :||                
  Fly   564 TRSNQMYIRFVSDSSVQKLGFSAALMLDVDECKFTDHGCQHLCINTLGSYQCGCRAGYELQANGK 628

Human   444 --------------PNGTLYSPPF---Y-SSKGYAFQ--------IYLNLAHVTNAGIYFHLISG 482
                          .||:||||.:   | :||...::        ::||.:|....|..|| .:.
  Fly   629 TCEDACGGVVDATKSNGSLYSPSYPDVYPNSKQCVWEVVAPPNHAVFLNFSHFDLEGTRFH-YTK 692

Human   483 ANDDQLQWPCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFSN 547
            .|.|.|                  .|..:|             .||      |..|:|       
  Fly   693 CNYDYL------------------IIYSKM-------------RDN------RLKKIG------- 713

Human   548 GTQFRRGGGYGTSAFITHER---LKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCS 609
                         .:..||.   :.|...|...:.|...||:....:....|.:       |.||
  Fly   714 -------------IYCGHELPPVVNSEQSILRLEFYSDRTVQRSGFVAKFVIDV-------DECS 758

Human   610 KTTCKNDGVCTVR----DGKAECRCQSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLII 670
                .|:|.|..|    .|..:|.|::|......|..|.:   ||....|..|            
  Fly   759 ----MNNGGCQHRCRNTFGSYQCSCRNGYTLAENGHNCTE---TRCKFEITTS------------ 804

Human   671 TLVSVYCTRKKYRERMSSNRPNLTPQNQHAF 701
                       |....|.|.|...|:|.:.:
  Fly   805 -----------YGVLQSPNYPEDYPRNIYCY 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 67/203 (33%)
Astacin 69..257 CDD:279708 66/197 (34%)
MAM 260..427 CDD:214533 44/235 (19%)
MAM 265..427 CDD:99706 44/230 (19%)
MATH 427..586 CDD:295307 40/245 (16%)
Required for proteolytic processing 595..607 1/11 (9%)
tldNP_524487.2 ZnMc_BMP1_TLD 137..338 CDD:239808 66/202 (33%)
Astacin 144..339 CDD:279708 66/196 (34%)
CUB 388..474 CDD:214483 14/85 (16%)
CUB 478..586 CDD:278839 22/109 (20%)
FXa_inhibition 595..630 CDD:291342 4/34 (12%)
CUB 634..750 CDD:278839 32/173 (18%)
FXa_inhibition 757..792 CDD:291342 11/38 (29%)
CUB 797..906 CDD:278839 8/51 (16%)
CUB 910..1023 CDD:278839
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.