DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MEP1B and CG15253

DIOPT Version :9

Sequence 1:NP_005916.2 Gene:MEP1B / 4225 HGNCID:7020 Length:701 Species:Homo sapiens
Sequence 2:NP_609758.1 Gene:CG15253 / 34916 FlyBaseID:FBgn0028948 Length:253 Species:Drosophila melanogaster


Alignment Length:213 Identity:83/213 - (38%)
Similarity:124/213 - (58%) Gaps:8/213 - (3%)


- Green bases have known domain annotations that are detailed below.


Human    50 EGDIRLDRAQIRNSIIGEKYRWPHTIPYV-LEDSLEMNAKGVILNAFERYRLKTCIDFK-PWAGE 112
            |||: :.....||....|.||||:.|.|. :...::...:..|::|.::....:|:.|| ....:
  Fly    37 EGDM-VPSGSSRNIWRNETYRWPNRIIYYHINSYIDEEHRNHIVSAIQKIESISCLTFKEATTDQ 100

Human   113 TNYISV-FKGSGCWSSVG--NR--RVGKQELSIGANCDRIATVQHEFLHALGFWHEQSRSDRDDY 172
            ..|::| .:..||:|.:|  ||  ::..|...||..|.|:.|:.|||||||||:|:||.:|||||
  Fly   101 KYYVNVTSEEGGCFSYIGYLNRVQQLNLQNNEIGVGCFRLYTIVHEFLHALGFFHQQSAADRDDY 165

Human   173 VRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMHYSKTAFQNGTEPTIVTRISDFEDVIGQ 237
            |:|:.:.|..|.|.||:.|:::..:.....|||.|||||...||....|.||:......||||||
  Fly   166 VQIVEENITEGMEFNFDKYTEETVNDFGEKYDYGSVMHYGPYAFSKNGERTILALEEGKEDVIGQ 230

Human   238 RMDFSDSDLLKLNQLYNC 255
            |::.|::|:.|||.:|.|
  Fly   231 RLELSETDIRKLNAIYKC 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MEP1BNP_005916.2 ZnMc_meprin 26..255 CDD:239809 82/211 (39%)
Astacin 69..257 CDD:279708 77/194 (40%)
MAM 260..427 CDD:214533
MAM 265..427 CDD:99706
MATH 427..586 CDD:295307
Required for proteolytic processing 595..607
CG15253NP_609758.1 Astacin 55..250 CDD:279708 77/194 (40%)
ZnMc_astacin_like 59..246 CDD:239807 71/186 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6346
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41174
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10127
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.