DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34282 and CG3348

DIOPT Version :9

Sequence 1:NP_001097830.1 Gene:CG34282 / 42248 FlyBaseID:FBgn0085311 Length:94 Species:Drosophila melanogaster
Sequence 2:NP_001303428.1 Gene:CG3348 / 50082 FlyBaseID:FBgn0040609 Length:98 Species:Drosophila melanogaster


Alignment Length:70 Identity:24/70 - (34%)
Similarity:39/70 - (55%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YNGQDIYAEPNCAIVEDHARKFRDISDPTHYWVCPEGQEKADYIQCPDNYAFMEQQQNCVVWEEW 86
            :||     ||:|..:::..|.||:..|||.||||.:...:|...:||.:..:.|:...||.:.:|
  Fly    18 HNG-----EPSCQGLDEVNRMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADW 77

  Fly    87 KWVEP 91
            .|.:|
  Fly    78 AWTDP 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34282NP_001097830.1 None
CG3348NP_001303428.1 ChtBD2 24..73 CDD:214696 16/48 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449153
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5S7
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20987
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.