powered by:
Protein Alignment CG34282 and CG3348
DIOPT Version :9
Sequence 1: | NP_001097830.1 |
Gene: | CG34282 / 42248 |
FlyBaseID: | FBgn0085311 |
Length: | 94 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001303428.1 |
Gene: | CG3348 / 50082 |
FlyBaseID: | FBgn0040609 |
Length: | 98 |
Species: | Drosophila melanogaster |
Alignment Length: | 70 |
Identity: | 24/70 - (34%) |
Similarity: | 39/70 - (55%) |
Gaps: | 5/70 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 YNGQDIYAEPNCAIVEDHARKFRDISDPTHYWVCPEGQEKADYIQCPDNYAFMEQQQNCVVWEEW 86
:|| ||:|..:::..|.||:..|||.||||.:...:|...:||.:..:.|:...||.:.:|
Fly 18 HNG-----EPSCQGLDEVNRMFRNYWDPTAYWVCDKQGTRARLQRCPQSQLYSEELGRCVHYADW 77
Fly 87 KWVEP 91
.|.:|
Fly 78 AWTDP 82
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34282 | NP_001097830.1 |
None |
CG3348 | NP_001303428.1 |
ChtBD2 |
24..73 |
CDD:214696 |
16/48 (33%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45449153 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2F5S7 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20987 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.840 |
|
Return to query results.
Submit another query.