DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc91C and Sbsn

DIOPT Version :9

Sequence 1:NP_650744.1 Gene:Muc91C / 42246 FlyBaseID:FBgn0038642 Length:950 Species:Drosophila melanogaster
Sequence 2:NP_757342.2 Gene:Sbsn / 282619 MGIID:2446326 Length:682 Species:Mus musculus


Alignment Length:97 Identity:22/97 - (22%)
Similarity:35/97 - (36%) Gaps:15/97 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   863 GASSSSSAGYPSAPSSSYGAPSTG---SGHSFSSAPSS-SYSAPPA---------GGSSSSGPYP 914
            |..:..:.|...|...::|. .||   :|.....|... :|:|..|         |...::|...
Mouse   550 GVQTGFNQGQKEAEKVAHGV-QTGVNQAGKETQKAGQGVNYAAGQAEKEAEKLGQGVHHAAGQEM 613

  Fly   915 SAPSQDSGYEYNGPS-QVPDTIQQSYSADGGY 945
            :...||.....|.|| :....:..|:...|||
Mouse   614 NRLQQDVHNGVNQPSKEANQLLNGSHQGQGGY 645

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc91CNP_650744.1 Mucin-like 224..319 CDD:292676
Mucin-like 327..419 CDD:292676
Mucin-like 397..516 CDD:292676
SbsnNP_757342.2 Borrelia_P83 <462..>600 CDD:114011 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2087
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.