DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7706 and Snip1

DIOPT Version :10

Sequence 1:NP_650742.2 Gene:CG7706 / 42244 FlyBaseID:FBgn0038640 Length:726 Species:Drosophila melanogaster
Sequence 2:NP_001014091.1 Gene:Snip1 / 313588 RGDID:1359268 Length:389 Species:Rattus norvegicus


Alignment Length:226 Identity:61/226 - (26%)
Similarity:92/226 - (40%) Gaps:72/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LPKP------KVIITEKP---------------RSEVPAEPPPPPLKIPKTPKSSPAAVCPYKVP 53
            :|:|      :|.:.|||               |..|.....||..:|||              .
  Rat   198 IPRPAGNKNKEVPVKEKPSFELSGALLEDTNTFRGVVIKYSEPPEARIPK--------------K 248

  Fly    54 KWSAPPAENQIYSFEVLKSGQIIDTVHQLQQQAVWTFGRLPE-NDVPAAHPTISRFHVVLQYKPK 117
            :|...|.:|.    |||       .|..:.:|:.:..||... .|:|..||:.|:.|.|.||:  
  Rat   249 RWRLYPFKND----EVL-------PVMYIHRQSAYLLGRHRRIADIPIDHPSCSKQHAVFQYR-- 300

  Fly   118 APPKPETAKEDDEMEEEDEEPKNDQPEGWYIYDMGSTHGTFLNKQRVPPKVYIRMRVGHMLKLGG 182
               ..|..:.|..:      .:..:|   ||.|:||.:|||||.:|:.|:.|..::...:||.|.
  Rat   301 ---LVEYTRADGTV------GRRVKP---YIIDLGSGNGTFLNNKRIEPQRYYELKEKDVLKFGF 353

  Fly   183 STRVYIL-----------QGPGEDEEPESEL 202
            |:|.|:|           :...||||.|.|:
  Rat   354 SSREYVLLHESSDTSELDRKEDEDEEEEEEM 384

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7706NP_650742.2 FHA_Kanadaptin 65..191 CDD:438729 39/137 (28%)
DSRM_Kanadaptin 263..345 CDD:380685
PTZ00108 <316..699 CDD:240271
Snip1NP_001014091.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..212 3/13 (23%)