DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7702 and Lrrn2

DIOPT Version :10

Sequence 1:NP_650740.1 Gene:CG7702 / 42242 FlyBaseID:FBgn0038638 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001170839.1 Gene:Lrrn2 / 289020 RGDID:1305482 Length:750 Species:Rattus norvegicus


Alignment Length:498 Identity:125/498 - (25%)
Similarity:198/498 - (39%) Gaps:132/498 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AALLLATEVRSQHEDIPYQPVSNIC-QTCLC----LSTQDVDHRTHFNLDCSVRNFEHILARWPE 72
            |||||:. ..|.:..:|..|....| ..|.|    ..|....:|....:||:    :..|...| 
  Rat     6 AALLLSW-AASTNTAVPVVPWRVPCPPQCACQIRPWYTPRSSYREATTVDCN----DLFLTAVP- 64

  Fly    73 QFGSQAIASGAASEIVVSYSGNRIKL--------LQQLPATNASLTLSCRHCGLQDLQAPLFMDV 129
                ..:.:|..:.::.|.|.:||:.        |.:|..:..|.: ..|.|   |.||     :
  Rat    65 ----PGLPAGTQTLLLQSNSISRIEQTELGYLANLTELDLSQNSFS-DARDC---DFQA-----L 116

  Fly   130 PNVQALYISWNDITDDALVPDLFRGPFRNTRYEPIGLRDLDLSHNRIVRLDRRLFEHTPHLTKLN 194
            |.:.:|::..|.::  .|....|.|..|        |::|.|:||::.|:..|.||...:|.:|:
  Rat   117 PQLLSLHLEENQLS--RLEDHSFAGLTR--------LQELYLNHNQLCRISPRAFEGLGNLLRLH 171

  Fly   195 LAYNKLSSLD--------EATTASIGS-------------VATLQRLDLSHNGLMTLPAQLFSKL 238
            |..|.|.::|        ......||.             :|.|:.|.|:...|..:.......|
  Rat   172 LNSNLLRTIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSLVLAGMSLREISDYALEGL 236

  Fly   239 TSLRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAFLSLKENSLQ--------GLVSLKRLNIS 295
            .||..|....|:.:.:|.      ::|.|  :.|..||.|.:|.||        .::.||.|.::
  Rat   237 QSLESLSFYDNQLAQVPK------RALEQ--VPGLKFLDLNKNPLQRVGPGDFANMLHLKELGLN 293

  Fly   296 SMPSLRSLEKGAL-NLPALEHLDCSRNSKLERLELADLLSSRNLSQLDLSWNALTTLVINATGSS 359
            :|..|.|::|.|| |||.|..||.:.|   .||......:..:|.|::       ||::|     
  Rat   294 NMEELVSIDKFALVNLPELTKLDITNN---PRLSFIHPRAFHHLPQME-------TLMLN----- 343

  Fly   360 NNSSNS----TNETWPRLRRMSISGNPWYCSCELFKALELIGLNHIDREW---DGTEARCETPYL 417
            ||:.::    |.|:.|.|:.:.:.|||..|.|.:              .|   .||..|    ::
  Rat   344 NNALSALHQQTVESLPNLQEVGLHGNPIRCDCVI--------------RWANATGTHVR----FI 390

  Fly   418 LAGSPLSNLTAERICKMVIPK--KYREVDEEPPRFLRRHYIIL 458
               .|.|.|.||       |.  :.|.|.|.|.|.:..|.:.|
  Rat   391 ---EPQSTLCAE-------PPDLQRRPVREVPFREMTDHCLPL 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7702NP_650740.1 leucine-rich repeat 110..131 CDD:275380 5/20 (25%)
leucine-rich repeat 132..165 CDD:275380 6/32 (19%)
LRR <165..>382 CDD:443914 67/250 (27%)
leucine-rich repeat 166..189 CDD:275380 9/22 (41%)
leucine-rich repeat 190..213 CDD:275380 7/30 (23%)
leucine-rich repeat 217..240 CDD:275380 5/22 (23%)
leucine-rich repeat 241..264 CDD:275380 4/22 (18%)
leucine-rich repeat 265..288 CDD:275380 9/30 (30%)
leucine-rich repeat 289..312 CDD:275380 11/23 (48%)
leucine-rich repeat 313..337 CDD:275380 6/23 (26%)
Lrrn2NP_001170839.1 LRRNT 28..72 CDD:214470 10/52 (19%)
leucine-rich repeat 51..69 CDD:275380 4/26 (15%)
leucine-rich repeat 71..94 CDD:275380 4/22 (18%)
LRR <85..>324 CDD:443914 69/268 (26%)
leucine-rich repeat 95..118 CDD:275380 8/31 (26%)
leucine-rich repeat 119..142 CDD:275380 5/24 (21%)
leucine-rich repeat 143..166 CDD:275380 9/22 (41%)
leucine-rich repeat 167..190 CDD:275380 6/22 (27%)
leucine-rich repeat 191..214 CDD:275380 2/22 (9%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..262 CDD:275380 6/30 (20%)
leucine-rich repeat 263..286 CDD:275380 6/22 (27%)
leucine-rich repeat 287..311 CDD:275380 11/23 (48%)
LRR_8 310..371 CDD:404697 20/75 (27%)
leucine-rich repeat 312..334 CDD:275380 6/24 (25%)
leucine-rich repeat 337..360 CDD:275378 7/34 (21%)
PCC 342..>420 CDD:188093 27/110 (25%)
leucine-rich repeat 361..373 CDD:275378 4/11 (36%)
Ig 430..514 CDD:472250
Ig strand B 441..445 CDD:409353
Ig strand C 454..458 CDD:409353
Ig strand E 480..484 CDD:409353
Ig strand F 494..499 CDD:409353
Ig strand G 507..510 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.