DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7702 and lron-3

DIOPT Version :10

Sequence 1:NP_650740.1 Gene:CG7702 / 42242 FlyBaseID:FBgn0038638 Length:537 Species:Drosophila melanogaster
Sequence 2:NP_001359588.1 Gene:lron-3 / 181643 WormBaseID:WBGene00007261 Length:363 Species:Caenorhabditis elegans


Alignment Length:256 Identity:56/256 - (21%)
Similarity:93/256 - (36%) Gaps:88/256 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 CLSTQDVDHRTHFNLDCSVRNFEHILARWPEQFGSQAIASGAASEIVVSYSGNRIKLLQQLPATN 106
            |::.|.||.....::   ..|:::|.:                    |::.||..:.|...|...
 Worm    70 CINAQFVDANVFLDI---ATNYKYIKS--------------------VTFHGNNFQDLTSTPLFG 111

  Fly   107 A-------SLTLSCRHCGLQDLQAPLFMDVPNVQALYISWNDITDDALVPDLFRGPFRNTRYEPI 164
            |       .|.||..:  :.:|.:....::||:|.|.||.|:|.                 :.| 
 Worm   112 ADSQTSLIKLNLSANY--IVNLNSNALRNMPNLQVLDISNNEIV-----------------FRP- 156

  Fly   165 GLRDLDLSHNRIVRLDRRLFEHTPHLTKLNLAYNKLSSLDEATTASI---------------GSV 214
              ||:|            ..:||||||:|.:.        .|.|.:|               ..:
 Worm   157 --RDVD------------FLKHTPHLTQLYMR--------RAFTVTINRTQQFELMLEMFRQAKL 199

  Fly   215 ATLQRLDLSHNGLMTLPAQLFSKLTSLRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAF 275
            ..||.||||:|.:..:|.::.....||..||:..|.......:...: |.:..:||:.|.|
 Worm   200 EYLQVLDLSYNFIHNVPFEIACPFPSLHTLDLRQNFLKNFIVNETCI-KEVNTINLSRNQF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7702NP_650740.1 leucine-rich repeat 110..131 CDD:275380 3/20 (15%)
leucine-rich repeat 132..165 CDD:275380 7/32 (22%)
LRR <165..>382 CDD:443914 31/126 (25%)
leucine-rich repeat 166..189 CDD:275380 5/22 (23%)
leucine-rich repeat 190..213 CDD:275380 6/37 (16%)
leucine-rich repeat 217..240 CDD:275380 8/22 (36%)
leucine-rich repeat 241..264 CDD:275380 4/22 (18%)
leucine-rich repeat 265..288 CDD:275380 4/11 (36%)
leucine-rich repeat 289..312 CDD:275380
leucine-rich repeat 313..337 CDD:275380
lron-3NP_001359588.1 LRR <86..>264 CDD:443914 52/237 (22%)
leucine-rich repeat 118..141 CDD:275380 4/24 (17%)
leucine-rich repeat 142..167 CDD:275380 12/56 (21%)
leucine-rich repeat 168..201 CDD:275380 6/40 (15%)
leucine-rich repeat 202..225 CDD:275380 8/22 (36%)
leucine-rich repeat 226..248 CDD:275380 4/22 (18%)
leucine-rich repeat 249..269 CDD:275380 4/11 (36%)
LRRCT 282..335 CDD:214507
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.