Sequence 1: | NP_650740.1 | Gene: | CG7702 / 42242 | FlyBaseID: | FBgn0038638 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001293349.1 | Gene: | iglr-3 / 171771 | WormBaseID: | WBGene00021353 | Length: | 488 | Species: | Caenorhabditis elegans |
Alignment Length: | 255 | Identity: | 70/255 - (27%) |
---|---|---|---|
Similarity: | 110/255 - (43%) | Gaps: | 62/255 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 103 PATNASLTLSCR---HCGLQDLQAPLFMDVPNVQALYISWNDITDDALVPDLFRGPFRNTRYEPI 164
Fly 165 GLRDLDLSHNRIVRLDRRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQRLDLSHNGL-- 227
Fly 228 MTLPAQLFSKLTSLRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAFLSLKENSLQGLVSLKRL 292
Fly 293 ------NISSMPSLRSLEKGALNLPALEHLDCSR---NSKLERLELAD--LLSSRNLSQL 341 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7702 | NP_650740.1 | leucine-rich repeat | 110..131 | CDD:275380 | 6/23 (26%) |
LRR_RI | <123..267 | CDD:238064 | 39/145 (27%) | ||
leucine-rich repeat | 132..165 | CDD:275380 | 9/32 (28%) | ||
LRR_8 | 165..227 | CDD:290566 | 14/61 (23%) | ||
leucine-rich repeat | 166..189 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 190..213 | CDD:275380 | 3/22 (14%) | ||
LRR_8 | 216..273 | CDD:290566 | 19/58 (33%) | ||
leucine-rich repeat | 217..240 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 241..264 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 263..321 | CDD:290566 | 17/66 (26%) | ||
leucine-rich repeat | 265..288 | CDD:275380 | 5/22 (23%) | ||
leucine-rich repeat | 289..312 | CDD:275380 | 6/28 (21%) | ||
leucine-rich repeat | 313..337 | CDD:275380 | 10/28 (36%) | ||
iglr-3 | NP_001293349.1 | LRR | <47..>196 | CDD:227223 | 48/193 (25%) |
leucine-rich repeat | 51..73 | CDD:275380 | 9/35 (26%) | ||
leucine-rich repeat | 74..97 | CDD:275380 | 8/35 (23%) | ||
leucine-rich repeat | 98..119 | CDD:275380 | 8/24 (33%) | ||
leucine-rich repeat | 120..141 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 142..163 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 164..185 | CDD:275380 | 5/20 (25%) | ||
Ig_3 | 243..319 | CDD:372822 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160157559 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24364 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.030 |