Sequence 1: | NP_650740.1 | Gene: | CG7702 / 42242 | FlyBaseID: | FBgn0038638 | Length: | 537 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011522516.1 | Gene: | CHAD / 1101 | HGNCID: | 1909 | Length: | 440 | Species: | Homo sapiens |
Alignment Length: | 318 | Identity: | 87/318 - (27%) |
---|---|---|---|
Similarity: | 126/318 - (39%) | Gaps: | 69/318 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 169 LDLSHNRIVRLDRRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQRLDLSHNGLMTLPAQ 233
Fly 234 LFSKLTSLRFLDVSGNEFSTMPASL--QLLGKSLVQLNLAGNAFLSLKENSLQGLVSLKRLNISS 296
Fly 297 MPSLRSLEKGAL----NLPALEHLDCSRNSKLERLELADLLSSRNLSQLDLSWNALTTLVINATG 357
Fly 358 S----------------------------------SNNSSNSTNETWP--RLRRMSISGNPWYCS 386
Fly 387 CELFKALELIGLNHIDREW-----DGTEARCETPYLLAGSPLSNLTAERICKMVIPKK 439 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7702 | NP_650740.1 | leucine-rich repeat | 110..131 | CDD:275380 | |
LRR_RI | <123..267 | CDD:238064 | 27/99 (27%) | ||
leucine-rich repeat | 132..165 | CDD:275380 | |||
LRR_8 | 165..227 | CDD:290566 | 16/57 (28%) | ||
leucine-rich repeat | 166..189 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 190..213 | CDD:275380 | 4/22 (18%) | ||
LRR_8 | 216..273 | CDD:290566 | 20/58 (34%) | ||
leucine-rich repeat | 217..240 | CDD:275380 | 10/22 (45%) | ||
leucine-rich repeat | 241..264 | CDD:275380 | 6/24 (25%) | ||
LRR_8 | 263..321 | CDD:290566 | 21/61 (34%) | ||
leucine-rich repeat | 265..288 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 289..312 | CDD:275380 | 11/26 (42%) | ||
leucine-rich repeat | 313..337 | CDD:275380 | 7/23 (30%) | ||
CHAD | XP_011522516.1 | LRRNT | 104..130 | CDD:279764 | |
leucine-rich repeat | 134..157 | CDD:275380 | 5/19 (26%) | ||
LRR_8 | 156..216 | CDD:290566 | 19/62 (31%) | ||
leucine-rich repeat | 158..181 | CDD:275380 | 4/25 (16%) | ||
LRR_RI | <171..363 | CDD:238064 | 54/198 (27%) | ||
leucine-rich repeat | 182..205 | CDD:275380 | 10/22 (45%) | ||
LRR_8 | 204..264 | CDD:290566 | 17/62 (27%) | ||
leucine-rich repeat | 206..229 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 230..253 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 254..277 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 278..301 | CDD:275380 | 9/26 (35%) | ||
LRR_8 | 302..361 | CDD:290566 | 10/58 (17%) | ||
leucine-rich repeat | 302..325 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 327..350 | CDD:275380 | 0/22 (0%) | ||
leucine-rich repeat | 351..373 | CDD:275380 | 4/21 (19%) | ||
LRRCT | 381..428 | CDD:214507 | 16/56 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D334557at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |