DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7702 and CHAD

DIOPT Version :9

Sequence 1:NP_650740.1 Gene:CG7702 / 42242 FlyBaseID:FBgn0038638 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_011522516.1 Gene:CHAD / 1101 HGNCID:1909 Length:440 Species:Homo sapiens


Alignment Length:318 Identity:87/318 - (27%)
Similarity:126/318 - (39%) Gaps:69/318 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 LDLSHNRIVRLDRRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQRLDLSHNGLMTLPAQ 233
            |:|..|....|....|...|:|..|:|.:   ..:.|....:...:..|..|.||||.:..|.|.
Human   137 LNLQRNNFPVLAANSFRAMPNLVSLHLQH---CQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAG 198

  Fly   234 LFSKLTSLRFLDVSGNEFSTMPASL--QLLGKSLVQLNLAGNAFLSLKENSLQGLVSLKRLNISS 296
            .|..||.|.:|.:..|:.:.:|..|  .|:...::|||  .|....|:..:.||...|:.|.:|.
Human   199 AFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLN--NNKIRELRAGAFQGAKDLRWLYLSE 261

  Fly   297 MPSLRSLEKGAL----NLPALEHLDCSRNSKLERLELADLLSSRNLSQLDLSWNALTTLVINATG 357
             .:|.||:.|||    || |..|:|  || :|.....|.|...|.:.:|.||.|.|.::..||..
Human   262 -NALSSLQPGALDDVENL-AKFHVD--RN-QLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQ 321

  Fly   358 S----------------------------------SNNSSNSTNETWP--RLRRMSISGNPWYCS 386
            |                                  .||..|.....:|  .|..::::.|||.|:
Human   322 SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCT 386

  Fly   387 CELFKALELIGLNHIDREW-----DGTEARCETPYLLAGSPLSNLTAERICKMVIPKK 439
            |      :|.||    |.|     ...:|.|.:|....|..:.:..|.|.||  .|.|
Human   387 C------QLRGL----RRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCK--FPTK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7702NP_650740.1 leucine-rich repeat 110..131 CDD:275380
LRR_RI <123..267 CDD:238064 27/99 (27%)
leucine-rich repeat 132..165 CDD:275380
LRR_8 165..227 CDD:290566 16/57 (28%)
leucine-rich repeat 166..189 CDD:275380 5/19 (26%)
leucine-rich repeat 190..213 CDD:275380 4/22 (18%)
LRR_8 216..273 CDD:290566 20/58 (34%)
leucine-rich repeat 217..240 CDD:275380 10/22 (45%)
leucine-rich repeat 241..264 CDD:275380 6/24 (25%)
LRR_8 263..321 CDD:290566 21/61 (34%)
leucine-rich repeat 265..288 CDD:275380 7/22 (32%)
leucine-rich repeat 289..312 CDD:275380 11/26 (42%)
leucine-rich repeat 313..337 CDD:275380 7/23 (30%)
CHADXP_011522516.1 LRRNT 104..130 CDD:279764
leucine-rich repeat 134..157 CDD:275380 5/19 (26%)
LRR_8 156..216 CDD:290566 19/62 (31%)
leucine-rich repeat 158..181 CDD:275380 4/25 (16%)
LRR_RI <171..363 CDD:238064 54/198 (27%)
leucine-rich repeat 182..205 CDD:275380 10/22 (45%)
LRR_8 204..264 CDD:290566 17/62 (27%)
leucine-rich repeat 206..229 CDD:275380 6/22 (27%)
leucine-rich repeat 230..253 CDD:275380 7/24 (29%)
leucine-rich repeat 254..277 CDD:275380 9/23 (39%)
leucine-rich repeat 278..301 CDD:275380 9/26 (35%)
LRR_8 302..361 CDD:290566 10/58 (17%)
leucine-rich repeat 302..325 CDD:275380 8/22 (36%)
leucine-rich repeat 327..350 CDD:275380 0/22 (0%)
leucine-rich repeat 351..373 CDD:275380 4/21 (19%)
LRRCT 381..428 CDD:214507 16/56 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334557at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.