DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7702 and chad

DIOPT Version :9

Sequence 1:NP_650740.1 Gene:CG7702 / 42242 FlyBaseID:FBgn0038638 Length:537 Species:Drosophila melanogaster
Sequence 2:XP_017953398.1 Gene:chad / 101732210 XenbaseID:XB-GENE-957654 Length:360 Species:Xenopus tropicalis


Alignment Length:384 Identity:97/384 - (25%)
Similarity:154/384 - (40%) Gaps:85/384 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LLQQLPATNASLTLSCRHCGLQDLQAPL-----FMDVPNV----QALYISWNDITDDALVPDLFR 153
            ||...|:...:...:| ||...|||..:     ...:|.|    :.|.:..|:.  ..|.|:.|:
 Frog    12 LLAAAPSLLRACPANC-HCHGGDLQHVICDTAGLTKLPKVSEQTRLLNLQRNNF--PVLAPNAFK 73

  Fly   154 GPFRNTRYEPIGLRDLDLSHNRIVRLDRRLFEHTPHLTKLNLAYNKLSSLDEATTASIGSVATLQ 218
                    |..||..|.:.|.:|..:....|.....|..|.|:.|::|.|.   |.:...::.|.
 Frog    74 --------EMKGLVSLHMQHCKIREVSSGAFRGLKRLVYLYLSNNEISVLG---TGAFDELSELT 127

  Fly   219 RLDLSHNGLMTLPAQLFSKLTSLRFLDVSGNEFSTMPASLQLLGKSLVQLNLAGNAFLSLKENSL 283
            .|.:.||.::.||..|||.|.:|..|.:..|:...:.|:.....|.|..|.|:.|...:::..||
 Frog   128 YLYMDHNKIIDLPKGLFSPLFNLFILQLGNNKVRDLKAATFTGAKDLRWLYLSDNEITNMQPGSL 192

  Fly   284 QGLVSLKRLN-----ISSMPSLRSLEKGALNLPALEHLDCSRN--------------SKLERLEL 329
            ..:.:|...:     :||.| |.::.|    |..:|.|..|||              ..:|.|.:
 Frog   193 DEVENLAIFHMDGNQLSSYP-LAAISK----LRVVEDLKISRNPIKIIPDFAFQSFGRYMESLSM 252

  Fly   330 ADL----------LSSRNLSQLDLSWNALTTLVINATGSSNNSSNSTNETWPRLRRMSISGNPWY 384
            .::          :....|..|::..|.|:.|..|...||             |:.::::.|||:
 Frog   253 ENMGVEKFSDKAFVGVTTLKTLNIEGNKLSQLPANVPYSS-------------LQSLALANNPWH 304

  Fly   385 CSCELFKALELIGLNHIDREW-DGTEAR----CETPYLLAGSPLSNLTAERICKMVIPK 438
            |:|:| .||         |.| ||:.||    |.:|....|..|.:..|.|.||....|
 Frog   305 CTCQL-AAL---------RRWVDGSRARPNATCASPSQYRGQQLKDTGAFRSCKQPTKK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7702NP_650740.1 leucine-rich repeat 110..131 CDD:275380 6/25 (24%)
LRR_RI <123..267 CDD:238064 37/152 (24%)
leucine-rich repeat 132..165 CDD:275380 7/36 (19%)
LRR_8 165..227 CDD:290566 17/61 (28%)
leucine-rich repeat 166..189 CDD:275380 5/22 (23%)
leucine-rich repeat 190..213 CDD:275380 7/22 (32%)
LRR_8 216..273 CDD:290566 18/56 (32%)
leucine-rich repeat 217..240 CDD:275380 10/22 (45%)
leucine-rich repeat 241..264 CDD:275380 4/22 (18%)
LRR_8 263..321 CDD:290566 17/62 (27%)
leucine-rich repeat 265..288 CDD:275380 6/22 (27%)
leucine-rich repeat 289..312 CDD:275380 7/27 (26%)
leucine-rich repeat 313..337 CDD:275380 7/47 (15%)
chadXP_017953398.1 LRRNT 22..>50 CDD:214470 7/28 (25%)
leucine-rich repeat 54..77 CDD:275380 6/32 (19%)
LRR_8 77..136 CDD:338972 17/61 (28%)
leucine-rich repeat 78..101 CDD:275380 5/22 (23%)
leucine-rich repeat 102..125 CDD:275380 7/25 (28%)
LRR <105..>302 CDD:227223 50/217 (23%)
leucine-rich repeat 126..149 CDD:275380 10/22 (45%)
leucine-rich repeat 150..173 CDD:275380 4/22 (18%)
leucine-rich repeat 174..197 CDD:275380 6/22 (27%)
leucine-rich repeat 198..221 CDD:275380 7/27 (26%)
leucine-rich repeat 222..245 CDD:275380 5/22 (23%)
leucine-rich repeat 247..270 CDD:275380 2/22 (9%)
LRRCT 301..348 CDD:214507 20/56 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334557at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.