| Sequence 1: | NP_650738.1 | Gene: | Cpsf73 / 42240 | FlyBaseID: | FBgn0261065 | Length: | 684 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_190401.1 | Gene: | AT3G48180 / 823973 | AraportID: | AT3G48180 | Length: | 77 | Species: | Arabidopsis thaliana |
| Alignment Length: | 31 | Identity: | 8/31 - (25%) |
|---|---|---|---|
| Similarity: | 13/31 - (41%) | Gaps: | 0/31 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 326 IGPCVIMASPGMMQSGLSRELFESWCTDPKN 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Cpsf73 | NP_650738.1 | CPSF3-like_MBL-fold | 18..211 | CDD:293850 | |
| YSH1 | 19..427 | CDD:440849 | 8/31 (26%) | ||
| CPSF73-100_C | 486..680 | CDD:463330 | |||
| AT3G48180 | NP_190401.1 | None | |||
| Blue background indicates that the domain is not in the aligned region. | |||||