DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpsf73 and AT3G48180

DIOPT Version :10

Sequence 1:NP_650738.1 Gene:Cpsf73 / 42240 FlyBaseID:FBgn0261065 Length:684 Species:Drosophila melanogaster
Sequence 2:NP_190401.1 Gene:AT3G48180 / 823973 AraportID:AT3G48180 Length:77 Species:Arabidopsis thaliana


Alignment Length:31 Identity:8/31 - (25%)
Similarity:13/31 - (41%) Gaps:0/31 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   326 IGPCVIMASPGMMQSGLSRELFESWCTDPKN 356
            :|.....||.|:.:..:...|..:|..|..|
plant    41 LGKTKAAASSGLKKVKIGTSLGLNWVKDKYN 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpsf73NP_650738.1 CPSF3-like_MBL-fold 18..211 CDD:293850
YSH1 19..427 CDD:440849 8/31 (26%)
CPSF73-100_C 486..680 CDD:463330
AT3G48180NP_190401.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.